KEGG   Myceliophthora thermophila: MYCTH_2140326Help
Entry
MYCTH_2140326     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MYCTH_2140326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3948071..3948685,3948799..3948900))
Genome map
AA seq 238 aa AA seqDB search
MAWRSSGASNRDLIENLWRNRLITHPEVKEAFLKVDRAHYAPSFPYDDSPQPIGHSATIS
APHMHASAVEHLLPYLVPSSSSPERPAPRVLDIGSGSGYLTAVMAELVGERGVVVGVEHI
NALRELGERNVAKSERGRELLQSGRIRFRVGDGRKGWVEPGEEAAKWDAIHVGAAAAEVH
ASLLDQLNAPGRMFIPVDDDGGGWSQHVWCVDKDEKGEVTRKKLFGVRYVPLTDAPKE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgcagctcgggtgcgtctaacagggacctaatcgagaatctctggcggaac
aggctcattacccaccccgaagtgaaagaagccttcctcaaagtcgaccgcgcgcactac
gcgccatcgtttccttatgacgactcgccccagcccatcggccacagcgccaccatctcg
gcaccgcacatgcacgcgtccgcggtagagcacctgctgccgtacctggtgccgtcctcg
tcgtcgcccgagcggccggccccgcgcgtgctggacatcgggtccgggtccgggtacctg
acggcggtgatggcggagctggtcggggagcgcggggtggtggtcggggtggagcacatc
aacgccctgcgggagctcggggagcgcaacgtggccaagtcggagcggggccgggagctg
ctgcagagcggccggatccgcttccgggtcggggacggccggaagggctgggtggaaccc
ggcgaggaagcggccaagtgggacgcgatccacgtcggcgccgccgccgccgaggtccac
gccagcctgctcgaccagctcaacgcgcccggccgcatgttcatccccgtcgacgacgac
ggcggcggctggagccagcacgtctggtgcgtggacaaggacgagaagggcgaggtgacc
aggaagaagctgtttggggtccgctatgtcccgttgacggacgcaccgaaggagtga

DBGET integrated database retrieval system