KEGG   Myceliophthora thermophila: MYCTH_2142488Help
Entry
MYCTH_2142488     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
mtm  Myceliophthora thermophila
Brite
Exosome [BR:mtm04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCTH_2142488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(9067117..9067251,9067387..9067542,9067655..9067739,9067815..9067830,9067911..9067923))
Genome map
AA seq 134 aa AA seqDB search
MSWQAYVDSSLVGSGHIDKACIVSAAGDSTWAATPGFAVGADELKNIVAILDEADKGGPA
VTKAFSDGIHVAGERYVAFRIEDKHIYGRQGRTGICIVKTKQAILIGHYGENVQAGNATQ
TVEALGDYLINQGY
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcctacgttgactcgagcctggttggctccggccacatcgacaaggct
tgcatcgtcagcgctgccggcgacagcacctgggccgcgaccccggggttcgcggttggc
gccgacgagctcaagaatatcgtcgccatcctggacgaggcagacaagggtggcccagcg
gtaaccaaggcgttctcggacggcattcacgtcgctggcgagcgctacgtagcctttaga
atcgaggacaagcacatttacgggcgccagggcaggaccggtatctgcatcgtcaagacg
aaacaggccatcctcattggtcactacggcgagaacgtccaggccggcaacgcgacacag
acggtcgaggccctcggcgattatctcatcaaccagggctactaa

DBGET integrated database retrieval system