KEGG   Thermothelomyces thermophila: MYCTH_2294427Help
Entry
MYCTH_2294427     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2294427
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MYCTH_2294427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 11513366
NCBI-ProteinID: XP_003658543
JGI: 2294427
UniProt: G2Q1A6
Position
1:join(1042734..1042991,1043128..1043460,1043690..1044070)
Genome map
AA seq 323 aa AA seqDB search
MVGRANKPKELVSTPGLPPQATVTFSEDNSRVRAELPTGESVEVLLYGATVISWKDASGD
EKLWLSDAAKLDGSRAVRGGIPVVFPVFSTAPDHPQTKDLPQHGFARTSRWEFLGKSTSE
SLVGKAANEPTVKLDFGLSSAAPGLDPKASAHWPFKFNLIYSVTLNQRSLTTSIVAANDD
SAPFDCQVLMHTYLRVKDITNVEITGLASAPYFDKVDSANPHKTQPAEPAAATITGETDR
VYTPAGDVTVAEGGVPRYRVTRENFGNVVVWNPWADKARAIPDFEPKHGFRNMLCVEPGA
VAGWQSVESGDAFEGAQTITLLD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtcggacgcgccaacaagccgaaggagttggtttcaacccccgggcttccaccccag
gcgacagtgaccttctccgaggacaactcgcgcgtcagggctgagctgcccacgggtgag
agcgtcgaagtgctcctctacggcgccacggtgatcagctggaaggatgcctcgggtgac
gagaagctctggttgagcgacgcggccaagctggacggcagccgggccgtgagaggcggc
atccctgttgtcttccctgttttcagcacagcccccgaccacccgcagaccaaggacctc
ccgcagcacgggttcgcgcgcacctcgcgctgggagttcctgggcaagtcgacgtccgag
tcgttggtgggcaaggccgccaacgagccgacggtgaagctcgactttggcctgagctcg
gccgcgccggggctcgaccccaaggcgtccgcccactggcccttcaagttcaacctgatc
tacagcgtgactctcaaccagcgcagcctgacgacgagcatcgtggccgccaatgacgac
agcgccccatttgactgccaggtcttgatgcacacgtacctgcgcgtcaaggacatcaca
aacgtagagatcaccggcctcgcgtcggcgccctacttcgacaaggtcgactcggcgaac
ccgcacaagacgcagccggccgagccggccgccgcgaccatcacgggcgagacggaccgc
gtgtacacgcccgccggggacgtgacggtcgccgagggcggcgtgccgcggtaccgcgtc
acgcgcgagaacttcggcaacgtggtcgtgtggaacccctgggcggacaaggcccgggcc
atcccggacttcgagcccaagcacggcttccggaacatgctgtgcgtcgagcccggcgcc
gtcgccggctggcagtccgtcgagtccggcgatgcctttgagggcgcgcagaccatcacc
ctcttggattga

DBGET integrated database retrieval system