KEGG   Myceliophthora thermophila: MYCTH_2294427Help
Entry
MYCTH_2294427     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2294427
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MYCTH_2294427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1042734..1042991,1043128..1043460,1043690..1044070)
Genome map
AA seq 323 aa AA seqDB search
MVGRANKPKELVSTPGLPPQATVTFSEDNSRVRAELPTGESVEVLLYGATVISWKDASGD
EKLWLSDAAKLDGSRAVRGGIPVVFPVFSTAPDHPQTKDLPQHGFARTSRWEFLGKSTSE
SLVGKAANEPTVKLDFGLSSAAPGLDPKASAHWPFKFNLIYSVTLNQRSLTTSIVAANDD
SAPFDCQVLMHTYLRVKDITNVEITGLASAPYFDKVDSANPHKTQPAEPAAATITGETDR
VYTPAGDVTVAEGGVPRYRVTRENFGNVVVWNPWADKARAIPDFEPKHGFRNMLCVEPGA
VAGWQSVESGDAFEGAQTITLLD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtcggacgcgccaacaagccgaaggagttggtttcaacccccgggcttccaccccag
gcgacagtgaccttctccgaggacaactcgcgcgtcagggctgagctgcccacgggtgag
agcgtcgaagtgctcctctacggcgccacggtgatcagctggaaggatgcctcgggtgac
gagaagctctggttgagcgacgcggccaagctggacggcagccgggccgtgagaggcggc
atccctgttgtcttccctgttttcagcacagcccccgaccacccgcagaccaaggacctc
ccgcagcacgggttcgcgcgcacctcgcgctgggagttcctgggcaagtcgacgtccgag
tcgttggtgggcaaggccgccaacgagccgacggtgaagctcgactttggcctgagctcg
gccgcgccggggctcgaccccaaggcgtccgcccactggcccttcaagttcaacctgatc
tacagcgtgactctcaaccagcgcagcctgacgacgagcatcgtggccgccaatgacgac
agcgccccatttgactgccaggtcttgatgcacacgtacctgcgcgtcaaggacatcaca
aacgtagagatcaccggcctcgcgtcggcgccctacttcgacaaggtcgactcggcgaac
ccgcacaagacgcagccggccgagccggccgccgcgaccatcacgggcgagacggaccgc
gtgtacacgcccgccggggacgtgacggtcgccgagggcggcgtgccgcggtaccgcgtc
acgcgcgagaacttcggcaacgtggtcgtgtggaacccctgggcggacaaggcccgggcc
atcccggacttcgagcccaagcacggcttccggaacatgctgtgcgtcgagcccggcgcc
gtcgccggctggcagtccgtcgagtccggcgatgcctttgagggcgcgcagaccatcacc
ctcttggattga

DBGET integrated database retrieval system