KEGG   Myceliophthora thermophila: MYCTH_2294755Help
Entry
MYCTH_2294755     CDS       T02231                                 

Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mtm  Myceliophthora thermophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mtm00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:mtm00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:mtm00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mtm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(1603419..1603850,1604002..1605168,1605274..1605423))
Genome map
AA seq 582 aa AA seqDB search
MWSPSLSSFSVLLAALQPVAAIWPAPQSLTTGSSVLYLNQNIKVTYNGESIPYTYGYVSR
ELTSKEVVQAGISRTLAGIFESKFVPWKLHKRGSKWEPDLSQGQQWIKTLEIVQKGKDEP
STFKPLAGQVDESYNLTVSAKGEAKLAAVSSIGVLRGLETFSQLFYQHSAGTFWYTPFAP
VSVQDAPKFPHRGVLIDTARNFLPVADILRTIDAMAWSKLNRLHVHVTDSQSWPLVIPSL
PEVSEKGAYHPSQTYSPEDVEKIQTYGAERGVEVYFEIDMPGHIGVVSLSHPELIVAYNL
QPYQWWCQEPPCGAFKLNNTAVDAFLDKLFDDLLPRLAPYSAYFHTGGDELNRNDSMLDE
GIRSNDTEVLRPLLQKFIDKQHARVRAAGLTPITWEEIPLEWEVDMAKDTVVQSWLGGDA
VKTLTSKGYQVIDSNYNFWYLDCGRGQWLTWGNGAAFAQGYPFNDWCGPTKSWQLVYQHD
PTAGLTAEEAKLVLGGEVALWAETIDPVNLDTLAWPRASAVGEALWSGRIDPATGQNRSL
VEAAPRLNEFRERLVARGVGASPIQMTFCTQGRAEECEFIVA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgccgtcactctcttcgttttctgttttattggctgctctgcagcccgtcgcg
gcaatctggccggcaccccaaagcttgacgacgggcagctcggttctatacttgaaccag
aacatcaaggtcacatacaatggagaatccattccgtacacgtacggatatgtgtctcgc
gagttgaccagcaaggaggtcgttcaggcaggcatttcccggacgctcgcgggcattttt
gagagcaagttcgtcccttggaagctgcacaagcgcgggtccaagtgggagcccgacctg
tcgcagggccagcagtggatcaagacgctggagatcgtccagaagggcaaggacgagccc
agcaccttcaagcccctcgccggccaggtggacgagtcgtacaacctgacggtgagcgcc
aagggcgaagccaagctcgcagccgtttcgtccatcggcgtgctccgcggcctcgagacc
ttctcgcagctgttctaccagcactcggccggcaccttctggtacaccccgttcgcgccc
gtgtcggtgcaggacgcgcccaagttcccccaccgcggcgtcctgatcgacacggcgcgc
aacttcctccccgtcgccgacatcctgcgcaccatcgacgccatggcctggagcaagctg
aaccggctgcacgtccacgtgaccgactcccagtcgtggccgctcgtgatcccctcattg
cccgaggtctcggagaagggcgcctaccacccgagccagacgtactcgcccgaggatgtc
gagaagatccagacgtacggcgccgagcggggcgtcgaggtgtactttgagatcgacatg
ccgggccacatcggggtggtgtcgctgtcgcacccggagctgatcgtggcctacaatctg
cagccctaccagtggtggtgccaggagccgccgtgcggcgccttcaagctcaacaatacc
gcggtcgacgcgttcctggacaagctgttcgacgacctcctgccgcggctggcgccgtac
tcggcctacttccacacgggcggcgacgagctcaaccggaacgactcgatgctggacgag
ggcatccggtccaacgacaccgaggtgctgcggccgctgctgcaaaagttcatcgacaag
cagcacgcgcgcgtccgcgcggccggcctgaccccgatcacctgggaggagatcccgctc
gagtgggaagtcgacatggccaaggacacggtcgtgcaatcgtggctgggcggcgacgcg
gtcaagacgctgaccagcaagggctatcaggtgattgacagcaactacaacttctggtac
ctcgactgcggccgaggccagtggctgacgtgggggaacggggcggcgttcgcccagggc
tacccgttcaacgactggtgcgggccgaccaagtcatggcagctagtgtaccagcacgac
ccgacggccgggctgacggccgaggaggccaagctcgtgctgggcggcgaggtggcactc
tgggccgagaccatcgacccggtcaacctggacacgctcgcctggccgcgcgccagcgcc
gtcggcgaggccctctggtccggccggatcgacccggcgacgggccagaaccggagcctg
gtcgaggccgccccgcggctcaacgagttccgcgagaggctggtcgccaggggagtcggg
gcctcgcccatccagatgaccttctgcacccagggaagggccgaggagtgcgagtttatc
gtcgcttga

DBGET integrated database retrieval system