KEGG   Myceliophthora thermophila: MYCTH_2294760Help
Entry
MYCTH_2294760     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCTH_2294760
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MYCTH_2294760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1610325..1610903,1611017..1611688,1611766..1612623)
Genome map
AA seq 702 aa AA seqDB search
MYATSLRCTARNPGGNGAKCGPLRTCRRFLSAHVANARRPLRSTPPPHHNLRPPAPTTTP
ALPSSSSPSSSPLSSPSSSPLRPAIPPRSRSQQRRHYAVGNKQHPPQTIAVLGGGLTGLT
TAWYLTRLLPEAKITIYEANKRLGGWIETEKAEVKTPDGKVGTVHFERAARMIKPQSAPA
RVPKWDDLVFYDLVTKLNLTDQLVHAKQDEEAVSGFIYYPDHLVPLPKVTIRLSDPLGAL
RQLANLAALLFEPLFRDLIPAVLNIFRTRKDPFRMDLFRGRRDMSVGDYYAYRLGSPALV
DKLMSAMVHGITGGDVWKLSMGSGFLADQLVPTDDEPITNVPVRSVDYEMMLQLARDKAV
FDLASQHLDTSALWFRDGFSTLTNALADALEKNPNVTFVTGQFVTRVEYIEKADKVGVHI
TRSLMEEPALYDKVVSTIFAKKLYKITDKLLPSLLPTTAVSIMLVNIWYPVPRINFPYNG
FGYLVPQALPFEQNPECVLGVIFDSDRESPLPTPSDPDPAPRGADTVQGTKLTVMMGGHY
YTDWPLHVTANTFRAKKAALAAVERHLRLPPELTEQAHASAKLCRDCIPQPLVGHARRMR
AAHSELEWTFKGRLAVVGQSYQNPGVLNMLRAARDVAVQIAGREEGAAAEWSVGDTGLER
FTRQPKYLSLQRHMLPLRYGSGAFVDESGQVRLREGALGTGG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcaaccagcctgcgctgcaccgcgcgcaatccgggcggcaatggcgccaagtgc
ggtccgctgcgaacctgccgccgattcctgagcgcccacgtcgccaacgcgcgtcgacca
ctgcgatctacccccccaccccaccataacctgcgcccgccagcaccgacgaccacaccg
gcattgccatcgtcatcatcaccatcatcatcaccactatcatcaccatcatcatcacca
ttacgaccggccatcccgccccggtccaggagccagcagaggcggcactatgccgtgggc
aacaagcaacacccgccgcagaccatcgccgtgctcggcggtggcctgaccggtctcacc
acggcatggtacctgacgcggctcctccccgaggccaagatcaccatctacgaggccaac
aagcgtctgggtggctggatcgagacggagaaggccgaggtcaagacgcccgacggcaag
gtcggcaccgtacactttgagcgcgccgcccgcatgatcaagccgcaatccgctccggcg
cgcgtccccaagtgggacgacctggtgttctacgatctggtcaccaagctcaacctgacc
gaccagctcgtgcacgcgaagcaggacgaggaggcggtctcgggcttcatctactatcct
gaccacctcgtcccgctccccaaggtcaccattcggctgtccgaccccctcggcgctctc
cggcaactcgccaacctcgccgccctgctcttcgagcccctctttcgcgacctgatcccc
gccgtcctcaacatcttccgcaccaggaaggaccctttcaggatggacttgttccgcggc
cgccgggacatgtcggtcggggactactacgcctaccggctcgggagccccgccctggtg
gacaagctcatgtcggccatggtccacggcatcacgggcggcgacgtgtggaagctgagc
atggggagcggcttcctggcggaccagctggtgcccacggacgacgagcccatcaccaac
gttcccgtgcgcagcgtcgactacgagatgatgctgcagctggctcgcgacaaggccgtc
ttcgacctggcctcgcagcacctcgacacgagcgcgctctggttccgcgacggcttcagc
accctgaccaacgcgctggccgacgcgctcgagaagaaccccaacgtcaccttcgtcacc
ggccagttcgtcactcgtgtcgagtacatcgagaaggcagataaagtcggggttcacatt
acgagatccctcatggaggaacccgccctgtacgacaaggttgtctcaaccatcttcgcc
aagaagctatacaagatcaccgacaagctgctcccctccctcctccccaccaccgccgtc
agcatcatgctcgtcaacatctggtacccggtcccgcgcatcaacttcccctacaacggc
ttcggctacctcgtcccgcaagctctccccttcgagcagaacccggagtgcgtcctcggc
gtcatcttcgactcggaccgcgagtccccgcttccgaccccgtccgacccggacccggcc
ccgcgcggggccgacacggtccagggcaccaagctcaccgtcatgatgggcggccactac
tacaccgactggcccctgcacgtcacggcgaacacgttccgcgccaagaaggcggccctc
gccgccgtcgagcgccacctgcgcctgccgcccgagctcaccgagcaggcgcacgcctcg
gccaagctctgccgcgactgcatcccccagcccctcgtcggccacgcaaggcgcatgcgc
gccgcccactccgagctcgagtggaccttcaagggccgcctcgccgtcgtcggccagagc
taccagaacccgggcgtgctcaacatgctgcgcgccgccagggacgtcgccgtccagatc
gccggccgcgaggagggcgccgccgccgagtggtccgtcggcgacaccgggctcgagcgc
ttcacccgccagcccaagtacctgtccctgcagaggcacatgctgcccctgcgctacggg
agcggcgcctttgtcgacgagtccggacaggtcaggctgagggagggcgccttgggaacc
ggagggtga

DBGET integrated database retrieval system