KEGG   Myceliophthora thermophila: MYCTH_2294840Help
Entry
MYCTH_2294840     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MYCTH_2294840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1780176..1780656,1780734..1781107,1781174..1781386)
Genome map
AA seq 355 aa AA seqDB search
MATATRTFTRALRTSARPAFAAAPRVAFRQAGRRFYSSEPAPKSSSSAWIWAAGAAAAGA
GGWYFLNNQSSATPQVFKPKYEDYQAVYNEIANRLEENSDYDDGSYGPVLLRLAWHASGT
YDKETGTGGSNGATMRFSPEADHGANAGLKAARDFLEPVKQKFPWISYSDLWILAGVCAI
QEMLGPQIPFRPGRQDKDVSACTPDGRLPDAAQGQDHLRNIFYRMGFNDQEIVALAGAHA
LGRCHTDRSGYSGPWTFSPTVLTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMMLPAD
MALVQDKKFKEWVQKYAADNDLFFRDFAAVITKLFELGVPFPENTERWVFKPVNA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcaactcgcaccttcacccgcgccctgcgcacctcggcccggcccgccttc
gccgccgctccccgggtggcattccgccaggctggccgtcgcttctactcgtcggagcct
gctccgaagagcagctcgtcggcgtggatctgggctgccggtgccgccgctgccggtgcc
ggtggctggtacttcctgaacaaccagagctcggccactccccaggtcttcaagcccaag
tacgaggactaccaggccgtgtacaacgagattgcgaaccgcctcgaggagaactcggat
tatgacgatggcagctatggccctgtgctgctgcgtctcgcctggcacgccagcggcacc
tatgacaaggagaccggcaccggcggcagcaacggcgccaccatgcgcttctctccggag
gccgatcacggcgccaacgccggcctgaaggctgcgcgggatttccttgagcctgtgaag
cagaagttcccttggatttcttactctgatctctggatcctcgctggcgtctgcgccatc
caggagatgctgggcccccagattcccttccgccccggccgccaggacaaggatgtctcc
gcctgcacccccgacggccgcctccctgatgccgcccagggccaggaccacctgcgcaac
atcttctatcgcatgggcttcaacgaccaggagattgttgctctggctggcgcgcacgct
ctcggccgctgccacaccgaccgctccggctactctggcccctggaccttctcgcccacc
gtcctgaccaacgactactacaagctgctgcttgacgagaagtggcagtggaagaagtgg
aacggccccaagcagtacgaggacaagaagaccaagtcgctcatgatgctgccggccgac
atggcgctcgtccaggacaagaagttcaaggagtgggttcagaagtacgctgccgacaac
gacctgttcttcagggatttcgcagccgttatcaccaagctgtttgagctcggtgtgccc
ttccccgagaacacggagcggtgggttttcaagcccgtcaacgcctaa

DBGET integrated database retrieval system