KEGG   Myceliophthora thermophila: MYCTH_2294959Help
Entry
MYCTH_2294959     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mtm  Myceliophthora thermophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCTH_2294959
   00052 Galactose metabolism
    MYCTH_2294959
   00500 Starch and sucrose metabolism
    MYCTH_2294959
   00520 Amino sugar and nucleotide sugar metabolism
    MYCTH_2294959
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYCTH_2294959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(1912831..1914121,1914175..1914251,1914315..1914410,1914945..1915052))
Genome map
AA seq 523 aa AA seqDB search
MAAQGVKSALPTHLKPGTNDDTEFAKRHHGKTRSHMAFENTSTNIAAAQMRNALTNLAET
VKDPEQKKLFETEMDNFFTLFRRYLNDKAKGNEVSWDRIAPPAEGQVVDYDDLPNSEAVQ
FLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSVRQVEYLNRTYGANVPIVLMN
SFNTDEDTAAIIKKYEGHGVDILTFNQSRYPRIYKDSLLPVPKSFDSPLHDWYPPGHGDV
FESLYNSGTLDKLLERGIEIIFLSNADNLGAVVDLRILQHMVESGAEYIMELTNKTKADV
KGGTIIDYEGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLHAIKRVVENNELEM
EIIPNGKTIPGDKKGESDISILQLETAVGAAIKHFRNAHGVNVPRRRFLPVKTCSDLMLV
KSDLYTVKHGQLQMSANRFGDAPLIKLGSDFKKVSDFQKRIPSIPKIIELDHLTITGAVN
LGRGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacaaggagtcaagagcgcccttcccacgcaccttaagccgggcaccaacgac
gataccgagttcgccaagaggcatcatggcaagacaagatcccacatggccttcgagaac
acctcgaccaacatcgcggccgcccaaatgcgcaatgcgcttacgaacctggccgagact
gtgaaggacccggagcagaagaagttgttcgagaccgagatggacaacttcttcacgctt
ttccgccggtacctgaacgacaaggccaagggcaacgaggtttcatgggatcgcattgcg
cctcctgccgagggccaggttgtcgactacgacgatcttcccaactcggaagccgtccaa
ttcctcaacaagctggcagtgctgaagctcaacggcggcctgggtacctctatgggttgc
gtcggccctaagtcggtcatcgaagttcgcgatggcatgtccttcctcgacatgtcggtc
cgccaagtcgagtacctcaatcgcacatatggcgccaatgtccccatcgtcctgatgaac
tcgttcaacacggacgaggataccgccgctatcatcaagaagtacgagggccacggggtg
gacatcctcaccttcaaccagtcccgctatcccagaatctacaaggactccctcctccca
gtgcccaagtctttcgactccccccttcacgactggtacccgccgggacacggcgacgtc
ttcgagtccctgtacaactcgggcaccctggataagctgcttgagcgcggcatcgagatc
atcttcctttccaacgccgacaaccttggcgccgtcgtcgaccttcgtatcctccagcac
atggtagagagcggggcggagtacatcatggagctgacaaacaagaccaaagccgacgtc
aagggcggtaccattatcgactatgaaggcagcgtgcgtctgctcgaaatcgctcaggtc
cccaaggagcacgtcaatgagttcaagtcgatcaagaagttcaagtacttcaacaccaac
aacatttggatgaacctccatgccatcaagcgcgtggtggagaacaacgaactcgagatg
gagatcatccccaacggcaagaccatccccggtgacaagaagggcgagtcggacatcagc
attctgcagctcgagacggccgtgggcgccgccatcaagcacttcaggaacgcccacggc
gtcaacgtgccgcgccgccgtttcctgcccgtcaagacctgctcagacctgatgctcgtc
aagtcggatctgtacactgttaagcacggccagttgcagatgagcgccaaccgcttcgga
gacgccccgctcatcaagctcggcagcgactttaagaaggtgtccgacttccagaagcgc
atccccagtatccccaagatcatcgagctcgaccatctcaccatcacgggtgccgttaac
ctcggccgcggcgtcaccctcaagggcaccgtcatcatcgtcgcgactgagggccagacg
atcgacatcccgccgggctccatcctggaaaacgtcgtcgtccagggtagcttgcgcctg
ctcgagcactaa

DBGET integrated database retrieval system