KEGG   Myceliophthora thermophila: MYCTH_2295601Help
Entry
MYCTH_2295601     CDS       T02231                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
mtm  Myceliophthora thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(3043268..3043396,3043538..3047915,3047993..3048207))
Genome map
AA seq 1573 aa AA seqDB search
MVSNEVYLLSLNDDGSPQVAGEYIYLAPKNNDPITIRFAIEGTSSICRHGSLWVNIPEKG
AEFRRDRFREFKLVPDFNRTIEISIPIYEAGVYAFYTTYAELPDLADNLTRSGRGSKPQT
KTTPWYYIDVAPRLTLDGQPLPLPALSVFSLISKFMGKYPQDWERHLRGISDRGYNMVHF
TPLQVRGASNSPYSLYDQLGWDPACFPEGETDVEKMVENLEKNYSLLSLTDIVLNHTANN
SPWLQEHPEAGYNLTTAPWLESAYLLDTKLLELGSKLEQLGLPTDLKSLDDLLKIMEAIK
KEVIGEIRLWEYYVIDVDGDADAAIEAWVAGEVKFPRGSLPPDGPGVLHSATSEELATWL
TKHGLKGMDRLGERFRRTVDPNVAAALLSALFGRYEGEYGATAGQAAVRNKIVEILDTVN
VPLYQEYDADLAETLQQIFNRIKYVRLDEHGPKLGPINQENPLIETYFTRLPRNEVTAKH
KKEDLVLVNNGWVWGGNALVDNAGPNSRVYLRREVIVWGDCTKLRYGDGPEDSPWLWEHM
TKYARMLAKYFAGFRIDNCHSTPIHVAEHILDEARRVRPNLYVVAELFTGSEEMDYVFVK
RLGLSSLIREAMQAWSTGELSRLVHRHGGRPIGSFEVDEISSAEVRSPAKERGDGAANGY
QYTREIIRRIKPVPIQALFMDCTHDNEVPAQKRDARDTLPNAALVSMCASTTGSVMGYDE
IYPRLVDLVNETRLYTSEASKFPVKVGEGKGGIAGVKKLLNQIHALMGMDGYDETHVHHE
DEYITVHRVQPDSRKGYFLIAHTAFPGYGNGNGALNPVRLTGTRAKHLGSWMLEVDSSKE
AVEEVLSDRKYLRGLPSRLVSVPGIRMEVKGDDTIITVRDRFPPGSIALFETWIPAAEHS
SGLDTFVTSGAKAAMEELDLVDLNFLLYRCEPEERDGSEGQDGVYDIPGHGKLVYAGLQG
WWSILKDIIRDNNLAHPLCQNLRDGQWALDYIVGRLERASQQQPAYSRLGKPAAWLRERF
DAIRNVPSFLLPRYFGLVLRTAYMAAFERGISLMSSNIRGAQWFVQSLAMVSVQQTSIVR
SASLYPDRLVPSLAAGLPHFAVEWARCWGRDVFISLRGLYLGTGRFEEAKEHIRAFASVL
KHGMIPNLLGSGNNPRYNSRDSVWFFLQCIQDYTRLAPDGLSLLDEKVKRRFLPYDDTWF
SVDDPRAYSKESTIREIIQEIFQRHAEGMRFREANAGPGLDMQMKDEGFNQEIKVDWSNG
FVFGGNQHNCGTWMDKMGESERAGSKGVPGTPRDGAAVEIIGLLYSALNWVATLNEQGKY
EQSSVRRADGSEISFRSWADLIKANFERCFFVPVSPSSDPDYDVNPSIVHRRGIYKDLYR
SGREYEDYQLRCNFPIAMTVAPELFDPSHAMHALCIADKVLRGPIGMATLDPSDLNYRPY
YHNSEDSDDFATSKGRNYHQGPEWLWPTGFFLRALLKFDLMRRPKDDAEGRTEAFQQVTR
RLKECKDMVRRSPWAGLTELTQKGGEECPDSCPTQAWSAGCLIDLYMDAAEEQAKVEGKA
LPPEVRREFGYEN
NT seq 4722 nt NT seq  +upstreamnt  +downstreamnt
atggtttccaacgaggtctaccttctgtcgctcaacgacgatggctcaccccaggtcgcc
ggcgagtatatctacctagcgcccaagaacaacgatcccatcaccatccgtttcgcaatc
gagggcacttcgagcatctgccgccatggcagcctgtgggtcaacatccccgagaagggc
gccgagttccgccgcgataggtttcgggagttcaagctcgttcccgacttcaatcgcacg
atcgagatctcaatcccaatctacgaagcgggcgtttacgcattctacacaacctacgcc
gagctgcccgatctagccgacaatctgacaagatccggccgcggttcgaagccccagacc
aagacaacgccatggtactacatcgacgttgccccgcggttgacgctggacggccagcca
ctccccctccccgcgctgtccgttttctcgctcatcagcaagttcatgggcaagtaccca
caggactgggagcgccatctgaggggaatcagcgaccgaggctacaacatggttcatttc
actcccctccaggtgaggggtgcttcgaattcgccctacagcctgtatgaccagcttggg
tgggacccggcctgtttccccgagggtgaaacggacgttgagaagatggtcgaaaatctg
gagaagaactactccctgctcagcctaacggacattgtccttaatcacaccgcaaacaac
agcccttggctacaggaacacccagaagccggctacaacttgacgacggccccgtggctg
gaatcggcatatctcctcgacacgaaactgctggaactgggctccaagttggaacagctg
ggactgccaacggatctgaagtctctggacgatctcctcaaaatcatggaagccatcaaa
aaggaggtcattggcgagatccgcctgtgggaatattatgtcatcgatgtcgacggagat
gccgatgcggcgatcgaagcttgggtcgctggcgaggtcaaattcccccgcggttccctg
ccccctgacggtccgggtgttcttcactcggcaacgtcggaggaactagcaacgtggttg
acgaagcacggcctcaaggggatggaccgcctaggagaacgattccggaggacagttgac
cccaacgttgctgctgccctgctttccgccctctttggacgatacgaaggcgagtacggt
gccaccgctggccaggcggctgtccgtaacaagattgtggagattctggacaccgtcaac
gtcccattataccaggaatacgacgcagatctggccgaaacccttcagcagatctttaac
cgaatcaaatatgtccgcttggatgagcatgggccgaagttgggtccgatcaaccaggaa
aatcctctcattgagacgtacttcacccggctgcccaggaacgaagtcacggcgaagcat
aagaaggaggacttggtcctggtcaataacggatgggtctggggcggaaacgcgctggtc
gacaacgccggaccgaactctcgggtctacctccgtcgtgaggtcatcgtctggggtgac
tgcaccaagctgaggtacggagacggtccggaagacagcccatggctctgggagcacatg
accaagtatgcgaggatgctagccaagtattttgccggctttcgcatcgacaactgccac
tcgactcctattcacgtcgccgagcacattctcgacgaggcccgccgtgtccgccccaac
ctctacgtcgtcgccgagctgttcaccggttccgaggagatggactacgtgtttgtaaag
cggttaggtcttagctcgctaattcgtgaggccatgcaagcctggagcaccggcgagctg
agccggctggttcatcggcacggcggccggcccattggcagcttcgaagttgacgagata
tcgagcgccgaggtgcgcagccccgcgaaggaacgcggagatggcgccgcaaacggttac
cagtacacgcgagagatcatacgccgcatcaagcccgtgcctatccaagccctcttcatg
gactgtacccacgacaacgaggttcctgcgcaaaagcgggatgcacgcgacaccctaccc
aacgcagccttggtcagcatgtgcgccagcacaaccgggagcgtcatgggatatgacgag
atctatcccagactggtcgacctcgtcaatgaaacccgactttacacatcggaggcgtcc
aagttcccggtcaaggttggtgagggcaagggaggcattgccggcgtcaagaagctgctc
aaccagatccacgccctgatgggcatggatggctacgacgagactcacgttcatcacgaa
gacgaatacatcacggtacaccgagttcaacccgactcgcggaagggatacttcctcatt
gcgcacaccgcgttccccggatatggcaatggaaacggcgctctgaatccggtccgcctg
acaggcacaagggcgaagcaccttggcagctggatgctcgaggttgactcaagcaaggag
gccgtcgaggaggtgttgagcgacaggaagtatctgcgcggccttcccagccgcctcgtc
tcagtccccggtatccgcatggaggtcaagggggatgacaccatcataaccgtgcgcgac
cggttcccgcccggcagcatcgcattgttcgagacctggatccctgctgccgagcactcc
agcggcctggatacctttgtcacatcaggcgccaaagcagcgatggaggagcttgacctg
gtggacctgaactttttgttgtacaggtgcgagccggaggagcgcgacggcagcgaaggg
caagatggtgtctacgatatcccgggccatggcaagcttgtctacgcgggcttgcagggg
tggtggagcatcctcaaagacatcatcagggacaacaaccttgcgcaccccctgtgccag
aaccttcgtgatggacagtgggcgctcgactacatcgtgggcagattggagcgtgcatcc
cagcagcaaccagcctacagtcgtctgggaaagcctgcagcgtggttaagagagaggttc
gacgcgatccgtaacgtccccagcttcctccttccgcgatactttggcttggtcctccgc
acggcctacatggcagcatttgagaggggcatctctctcatgagcagcaacatccgaggc
gcgcagtggtttgtgcagagcctggccatggtcagtgtgcagcagacgagcatagtcagg
tccgcctccctctatccggaccgccttgtcccgtcgctcgctgccggccttccgcacttc
gcagtcgagtgggcgcgctgctggggccgggacgtcttcatctctctgcggggcttgtac
cttggcaccggacgtttcgaggaagcaaaggaacatatccgtgcctttgccagcgtgctc
aagcacggcatgatccccaacttgctcggcagtggcaacaacccgcgctacaactcgcgc
gactcggtttggttctttctgcagtgcatccaggattacacccgccttgcccccgatggc
ttgtcgctgcttgatgagaaggttaagagacggttcctgccgtatgacgacacgtggttc
tcggtcgacgatccccgggcgtacagcaaggagagtacaatccgcgagatcattcaggag
atcttccagcgccacgccgaggggatgagattccgcgaagcaaacgccggccccggcctc
gacatgcagatgaaggacgaagggttcaaccaggagatcaaggtagactggagcaacggc
ttcgtctttggcggcaaccagcacaattgcggcacctggatggacaagatgggcgagagc
gagcgcgcgggctccaagggcgtacccgggaccccgcgtgacggtgccgctgtcgagatc
atcggtcttctgtacagcgctctcaactgggtcgcaaccttgaacgagcagggcaagtac
gagcagtcctccgtccgcagggccgacggctccgagatctccttccgctcctgggccgac
cttatcaaggccaactttgagcgctgcttcttcgtccccgtctccccctcgtccgacccc
gactacgacgtcaatccttccatcgtccaccgccgcggcatctacaaggacctctaccgc
tcgggcagggaatacgaggactaccagctgcgctgcaacttccccatcgccatgacggtc
gccccggagctcttcgacccgtcgcacgcgatgcacgccctctgcatcgcagacaaggtc
ctgcgcggccccatcggcatggccacgctggacccgagcgacctcaactaccggccgtac
taccacaacagcgaggacagcgacgacttcgccaccagcaagggccgcaactaccaccag
ggccccgagtggctgtggccgaccggctttttcctgcgcgccctgctcaagttcgacctg
atgcggcgccccaaggacgacgccgagggccggaccgaggcgttccagcaggtcacccgg
cgactcaaggagtgcaaggacatggtcaggcgcagcccctgggccggcttgaccgagctg
acgcagaagggcggcgaggagtgtcctgattcgtgccctacccaggcttggtctgcgggc
tgtctgattgatctgtacatggatgctgccgaggagcaggcgaaagtagagggcaaggcg
ctgcctcctgaggtgagacgggaatttggatatgagaattag

DBGET integrated database retrieval system