KEGG   Myceliophthora thermophila: MYCTH_2295647Help
Entry
MYCTH_2295647     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
mtm  Myceliophthora thermophila
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCTH_2295647
Exosome [BR:mtm04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCTH_2295647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(3119606..3119695,3119777..3120148,3120202..3124431,3124490..3124849)
Genome map
AA seq 1683 aa AA seqDB search
MAPALPIKFQELLQLSSLGVNQTAITFNTCTLESDSFICLRDKKDEASSPEVIIVDLKNG
NNVIRRPIKADSAIMHWSRQVIALKAQLRTLQIFDLEQKQKLKSTTMSEDVVFWKWTNER
TLGLVTDTAIYHWDVFDPTQATPVKVFDRNANLQSNQIINYRTSADGKWMVVVGISQQQG
RVVGAMQLYSKDRGISQAIEGHAAAFGTIRLEGAPEDTKLFTFAVRTAVGAKLHIVEVDH
PETNPVFPKKAVDVFFPPEAASDFPVALQVSQKYGIIYLITKYGFIHLYDLETGTCIFMN
RISGETIFTACGDKESSGVLGINRKGQVLFVSADENTIVPYVLESHGTDLALKLASRAGL
PGADNLYQQRFEQLFANGNYQEAAKVAANSPRGFLRTPQTIERFKRLPQQPGQMSYILQY
FGMLLDKGSLNQHETIELAQPVLAQNRKQLLQKWLGENKLECSEQLGDMVRPHDMTMALA
IYLKANVPHKVVAGFAETGQFEKILPYCAQVGYQPDFVQLLQHIVRVNPEKGAEFATSLA
NHEGGSLVDLERVVDIFQSQGMVQQATAFLLDALKDNRPDQGHLQTRLLEMNLINAPQVA
DAILGNDMFSHFDKARIASLCEQAGLLQRALDLYEDPAAVKRVIVNIPGMPNFSPDWLIE
YFGRLSVEQSIECLDAMMKHNIRQNLQSVVQIATKYAELLGAQRLIDLFEKYKTAEGLYY
FLGSIVNVSEDPEVVFKYIEAATKMGQIREVERICRDNSVYNPEKVKNFLKEARLPEMLP
LMVVCDRFNFVHDLVLYLYQHQQFKSIEVYVQQVNPSRTPGVIGGLLDVDCDESIIKNLL
ATVNPALIPIDELVHQVETRNRLKLLLPFLEATLAAGNQQQAVYNALAKIYIDTNNNPER
FLKENDQYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELVNITNENSMYKAQARYLLERAD
RELWMFVLSENNIHRRSVVDQVISTAVPESTDPAKVSEAVACFLNADLPAELIELLEKIV
LEPSPFSDNQNLQNLLIFTAAKADKARVMDYIHRLDNFSPDEIANVCIEVGLYEEAFEVY
KKIDNKEAAVNVLVEHVVSIDRAQAYAEEVDIPQVWSKVAKAQLDGLRVSDSIESYIKAE
DPKNYEEVIEIAVAAGKNEELIKFLRMARKTLREPVIDTALAFCYARLDQLADLEDFLRA
TNVANVEESGDKAYAEGLFEAAKIFYTSISNWAKLATTLVHLEDYQAAVDCARKANNIKV
WKEVHEACVGKKEFRLALICGLNLIVDAEQLQALVKQYERNGYFDELINLLEQGLGLERA
HMGMFTELGIALSKYHPERLMEHLKLFWSRVNLPKLIRACEEANLWPELVFCYYHYDEFD
NAALAVMERPENSWEHQQFKEIIVKVANLEIYYKAINFYLEQHPSLLTDLLQALTPRIDV
NRVVRMFQKSDNLPLIKPFLLNVQSQNKRTVNDAINDLLIEEEDYKTLRDSVENYDNYDA
VDLAGRLEKHDLVFFRQIAANIYRKNKRWEKSINLSKQDKLWKDAIETAAISGKPDIVEE
LLRYFVDVGNRECYVGMLYACYDLIRPDVVLELSWRNGLHDFSFPYFINMLSIQTKEIAA
LKADNEARKAREKEQEKAEDNTPILGVNRLMITAGPAGGAPPASPMPYNQTNGFAPQPTG
YGF
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggcattgccaattaaattccaagagctgctccagctgagcagcctaggcgtc
aaccaaaccgccattaccttcaacacctgtaccctagaatcagattccttcatttgtttg
cgagacaagaaggacgaggcgtcatctcccgaagtcatcatcgtcgacctcaagaatggc
aacaacgttatccgtcgacccatcaaggccgacagcgcgattatgcactggtcgcgtcag
gttattgccctgaaggcccagttgcgaacactgcagatcttcgacctggagcagaagcag
aagctaaaatcgacgaccatgagcgaagacgtcgtcttctggaagtggaccaacgagagg
actctgggcttggtgacggacaccgcgatctaccactgggacgttttcgatcccactcag
gcgactcctgtcaaggtgttcgatcgcaatgccaaccttcagagcaaccagatcatcaat
taccggacgagcgccgatggaaagtggatggtcgtggtcggcatctcgcagcagcaaggg
cgcgtcgtcggcgccatgcagttgtattcgaaagatcgcggtatcagccaagcgatcgag
ggccatgctgccgcctttggcacaatccgattagagggtgcacctgaggataccaagctc
ttcaccttcgccgtccggactgccgttggcgcgaagttgcacatcgtcgaagtcgaccat
ccagagacgaacccggtgttcccaaagaaggctgtcgacgttttcttcccgccggaagct
gccagtgacttccccgtcgctctccaagtttcgcagaaatacggcatcatttacctcatt
accaagtacgggttcattcacctctacgacctcgagaccgggacgtgtatcttcatgaat
cgcatctcgggcgagaccatcttcacagcctgcggtgacaaggagtcgagtggcgttctc
ggcatcaaccggaagggtcaggttctcttcgttagcgctgacgagaacacgattgtcccg
tacgttcttgagagccacggcaccgacctggcactcaagcttgcatcgcgtgccggtctc
ccgggtgcggacaacctgtaccagcagcgctttgagcagctctttgccaacggcaattac
caagaagccgccaaggtcgcggccaactctccgcgtggcttcctgcggacgccgcaaacc
atagagcggtttaagcggctcccccaacaaccgggtcagatgtcgtacatccttcaatac
tttggtatgctcctcgacaagggttcacttaaccagcacgaaacgatcgagctggcgcaa
cccgtactggctcagaatcggaagcaactgctacagaagtggctcggtgagaacaagctc
gagtgctctgagcagctcggtgacatggttcgccctcacgacatgaccatggccctggct
atctacctgaaagcaaacgtgccgcacaaagtcgttgctgggttcgctgagaccggccag
ttcgagaagatcctcccctactgcgcccaggttggctaccaacccgactttgtccagctc
cttcagcacattgtccgcgtcaacccggagaagggtgctgaatttgctacgtcgctggcc
aaccatgaaggagggtccctggtcgatctcgagcgggtggtggacatcttccagtcccaa
ggcatggtgcagcaagccacggcattcctccttgatgcgcttaaggacaataggcccgac
caaggccatcttcaaacccgccttctcgagatgaacttgatcaatgcgccccaagtcgcg
gatgctattcttgggaacgacatgttctcccactttgacaaggcccgcattgcctctctg
tgcgagcaagccggcctcctgcaaagagcgcttgatctatacgaagacccagccgccgtc
aagcgcgtcatcgtcaacatccccggcatgcccaacttcagccctgactggctgatcgaa
tactttggccggctctcggtcgagcagtccattgaatgcctcgatgcgatgatgaagcac
aacattcggcaaaaccttcaatccgtggttcaaatcgccaccaaatatgcagagcttctc
ggtgcccagcggttgattgatctgttcgagaagtacaagaccgccgaaggcctctactac
ttcctcggcagcatcgtcaacgtcagcgaggaccctgaagtcgtcttcaaatacattgag
gctgccacgaaaatgggtcaaatccgcgaggtcgagcgcatctgccgtgacaacagtgtc
tacaacccggagaaggtgaagaacttcctcaaagaagccaggcttcccgagatgctcccc
ttgatggtcgtctgcgaccgcttcaacttcgttcacgacctggtcctttacctgtaccag
caccaacagttcaagtccatcgaagtctatgttcaacaggtcaacccttccaggacgcct
ggtgtgattggcggcttgttggacgttgattgcgacgagagcatcatcaagaacctcctt
gccacggtcaacccggccttgattcccattgacgagttggtgcaccaagtcgagacacgt
aatcgcctcaaattgcttcttcccttccttgaggctaccctggctgctggtaaccaacaa
caagccgtctacaatgcgctggcgaagatttatatcgacaccaataacaacccggagagg
ttcttgaaggagaacgaccaatatgacacgctcactgttggcaagtactgcgagaagcgg
gaccccaaccttgcctacattgcctaccgcaagggccagaacgacctcgagctcgtcaat
atcaccaacgaaaactccatgtacaaggcccaggcaaggtatctgcttgagcgtgccgac
agggagctctggatgttcgttctgagtgagaacaatatccaccgccgctcagtggttgat
caggtcatctccaccgccgttccggagtccacagatcccgccaaggtttctgaggccgtg
gcctgcttcttgaatgccgatctccctgccgagcttattgagctcctggagaagattgtt
ctggagccgtcgccgttcagcgacaaccagaacctccagaacctgctcatcttcacggcc
gccaaggctgacaaggcgcgcgttatggactacatccaccggctcgacaacttctctccc
gatgagatcgccaatgtttgtatcgaggttgggctgtacgaggaagcattcgaggtctac
aagaaaatcgacaacaaggaggccgcggttaacgttcttgtcgagcacgtcgtcagcatc
gaccgcgcacaagcgtatgccgaggaggtcgacattccacaagtctggagcaaggtggcc
aaggctcagcttgacggccttcgagtcagcgactcgatcgagtcgtacatcaaggccgag
gatcccaagaactatgaagaggttatcgagatcgcggtcgcagccggcaagaacgaggag
ctcatcaagttcctccgcatggctcgcaagacgcttcgcgagccggtcattgatactgcc
ttggctttctgctatgcgcggctcgaccagcttgcggaccttgaggacttcctgcgggcc
accaacgtggctaatgttgaagagtccggagacaaagcctacgcggagggacttttcgaa
gcggccaagatcttctacactagcatctccaattgggccaagctcgccaccactctcgtt
cacctcgaggactaccaagctgctgtggactgtgcccgcaaggccaacaacatcaaggtc
tggaaggaggttcacgaggcttgcgtgggcaagaaggagttccgccttgcgctgatctgc
ggtctcaaccttatcgtggatgctgaacaactgcaagcgctcgtcaagcagtacgagcgg
aatggctacttcgacgagctcatcaacctccttgagcaaggccttggtctcgaacgcgcg
cacatgggcatgttcaccgagctcggtattgccctgtccaagtaccaccccgagcggttg
atggagcacctcaagctcttctggagcagggtgaacctgccaaagttgatccgtgcttgc
gaggaagccaacttgtggcccgaactggtcttttgctactatcactacgacgagtttgac
aatgctgcgctcgcggttatggaacggcccgaaaactcgtgggagcaccagcagttcaag
gagatcatcgtcaaggttgccaaccttgagatctattacaaggccatcaacttctacctt
gagcaacatccctcgctgctcaccgatcttctgcaagccctgacaccccggatcgacgtg
aacagggtagtccgcatgttccaaaagtcggacaacctgccgctgatcaagccgttcctg
ctgaacgttcagtcgcagaataagcgcactgtgaacgacgccatcaacgacctgctcatc
gaggaagaagactacaagacgctccgggactcggtggagaattatgacaattacgatgcc
gtcgatctcgctggccgcctcgagaagcatgatttggtgttcttccgccagatcgctgcc
aacatctaccgcaagaacaagcggtgggagaagtcgatcaacctgtccaagcaagacaag
ctctggaaggatgctatcgagactgcagccatttcgggcaagccggatattgttgaggag
ctcctgcgatactttgtggatgtcggcaaccgcgagtgctacgttggcatgctgtatgcc
tgctacgacttgatccggcctgacgtggtgctcgagttgtcgtggcgtaatggcctccac
gacttcagcttcccctacttcatcaatatgctgtccatccaaaccaaggaaattgctgcg
ctcaaggcggacaacgaggcccgcaaggcccgggaaaaggagcaggagaaggccgaggac
aacacgcccattcttggcgtcaaccgcctcatgattactgcgggtccggccggcggtgca
ccccctgcttcgcctatgccgtacaatcaaaccaatggcttcgcaccccagccaaccggc
tacggcttttag

DBGET integrated database retrieval system