KEGG   Myceliophthora thermophila: MYCTH_2296005Help
Entry
MYCTH_2296005     CDS       T02231                                 

Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mtm04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(3734397..3735567,3735639..3735855,3735931..3736063))
Genome map
AA seq 506 aa AA seqDB search
MYKAQKFALGLLAAAAVATASDVVQLKKDTFDDFIKSNDLVLAEFFAPWCGHCKALAPEY
EEAATSLKEKNIKLVKVDCTEETELCQQHGVEGYPTLKVFRGLDNVAPYKGQRKAAAITS
YMVKQSLPAVSEVTKDTLEEFKKADKVVIVAYVDADDKTSSEVFTKTAEKLRDNYPFGLS
TDAALAEAEGVKAPAIVLYKDFDEGKAVFTEKFDLEEIEKFAKTAATPLIGEIGPETYSD
YMSAGIPLAYIFAETAEERKEISEKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDK
FPAFAIQETTKNQKFPFDQDKEITFESIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVV
VAKSYNDIVLDDTKDVLIEFYAPWCGHCKALAPKYEKLGSLYAASEFKDKVVIAKVDATA
NDVPDEIQGFPTIKLYPAGDKANPVTYSGSRTVEDLIKFVAENGKYKASISEEPEEKTSS
SSAASESASASETKSEEAKETDHDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggcccagaagttcgctctcggcctgctcgccgcggcggcagttgccacggct
tcggatgttgtccagctgaagaaggacaccttcgacgacttcatcaagtccaacgacctt
gtcctcgctgagttctttgccccgtggtgtggtcactgcaaggcgctcgctcccgagtac
gaagaagctgcgacctcgctcaaggagaagaacatcaagctcgtcaaggtcgactgcaca
gaagagaccgagctctgccaacagcatggcgttgagggctacccgaccctgaaggtcttc
cgcggcctcgacaacgtcgccccctacaagggccagcgcaaggctgctgccatcacctcc
tacatggtcaagcagtcgctgcccgccgtctctgaggttaccaaggacaccctcgaggag
ttcaagaaggccgacaaggttgttatcgtggcctacgttgatgccgatgataagacgtcc
agcgaagtcttcaccaagaccgcggagaagctccgtgacaactaccccttcggtctcagc
accgacgctgccctggccgaggccgagggcgtcaaggctcccgccatcgtcctctacaag
gactttgatgagggcaaggctgtcttcaccgagaaattcgaccttgaggagattgagaag
tttgccaagaccgcggccaccccgctcattggcgagattggccccgagacctactcggac
tacatgtcggctggcatccccctcgcctacatcttcgccgagacggccgaggagcgcaag
gagatcagcgagaagctcaagcccatcgctgaggcccagcgtggtgtcatcaacttcggt
accattgacgccaaggcgttcggtgcccacgctggcaacctgaacctgaagacggacaag
ttccccgctttcgccattcaggagaccactaagaaccagaagttcccctttgaccaggac
aaggagatcacgttcgagtccatcaaggctttcgttgacgactttgttgccggcaagatc
gagcccagcatcaagtcggagcccatcccggagaagcaggagggccccgtgaccgttgtc
gtcgccaagagctacaacgacattgtccttgacgacaccaaggatgtcctgattgagttc
tacgccccgtggtgcggtcactgcaaggctctggctcccaagtacgagaagctcggctct
ctgtatgccgccagcgagttcaaggacaaggtcgtcatcgccaaggttgatgccactgcc
aacgacgtccccgatgagatccagggcttccctaccatcaagctctaccccgctggtgac
aaggccaaccccgtcacctactctggctctcgcactgtcgaggacctcatcaagttcgtt
gccgagaacggcaagtacaaggccagcatctccgaggagcctgaggagaagacttcttcg
tcgtcggccgccagcgagtctgctagcgccagcgagaccaagtcggaggaggctaaggag
acggaccacgacgagctctaa

DBGET integrated database retrieval system