KEGG   Myceliophthora thermophila: MYCTH_2296063Help
Entry
MYCTH_2296063     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3836147..3836824)
Genome map
AA seq 225 aa AA seqDB search
MNALAKKLGLSDDLTFYDVYSLDEPELLAIIPITPAWKKDREAEDEALGDPATYYNGGEA
TGAGEEPIIWFKQIIGDTCGSYGFLHCAINGQTPKFILPGSTLERLRNDAMPLPRDERAR
LLHDSKEFEEAHRSVAALGDTPEPSEGGPEHSGQHFVAYVKVNGRLWELEGSREGPLDRG
PLGEGEDVLSHRALDLGLKRIMNLSAGTDEENINFSCTVLAPRTA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctagccaagaagctcggcctctccgacgacctaaccttctacgacgtctac
tcattggacgagcctgaactgctcgccatcattcccattaccccagcgtggaagaaagac
cgcgaggcagaggacgaggcgctcggcgatccggccacctactacaatggcggagaggcc
accggggccggggaggaaccgatcatatggttcaagcagatcatcggcgacacatgcggc
tcctacggcttcctacactgtgccatcaacggccagacacccaagtttatccttcccggg
agcactctcgagcggctgcgcaacgacgccatgccgctgcccagggacgagcgggcccgg
ctgctgcacgatagcaaggagtttgaggaggcccatcggtccgttgccgcgctgggggat
accccagagcccagcgaggggggccccgagcacagcggccagcacttcgtagcgtacgtc
aaggtgaacggccgcctctgggagctcgagggttcacgggaggggccgctggaccgaggc
ccgctcggggagggcgaggacgtcttgagccacagagcactggacctgggcctgaagcgc
atcatgaacctgagcgccggcaccgacgaggagaacatcaactttagctgcacggttctc
gccccccggacggcctga

DBGET integrated database retrieval system