KEGG   Myceliophthora thermophila: MYCTH_2296151Help
Entry
MYCTH_2296151     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mtm00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3948587..3950578)
Genome map
AA seq 663 aa AA seqDB search
MRLSDLLPLALLPHCTSAAAGEPVIKRTAVRNDDVTISARARPDAPDGYAPAVVPCPQDK
PTIRSASSLSKSESDWLAKRRPLTVEPMIQLLKRANIEGFDAEAYINRVADDVKDLPNIG
IAVSGGGYRALMNGAGFIAAADSRTPGSTDKGGIGGLLQASTYLSGLSGGGWLVSSIYAN
NFTTVTALRDGSEDSSVWKFDSSIFTGPDLPGILDTARYWAKVASQVASKKDAGFETSIT
DYWGRALSWQLIDAPDGGPSYTFSSIADDDDFSNARTPFPILVADERAPGQKIISLNATV
FEFNPYEMGSWDPTTFGFAPIRYLASNFSAGVVPRDGNCVRGFDSISYIFGTSSSLFNAF
LLQNITSVDGVPDFLVDAATAVLEGISAEENDIAQYVPNPFLGWNRQANPAAESDSLDLV
DGGMDLQNIPLHPLIQPLRAVDVIFAVDSSADTTYSWPNGTAMRASYDRSHGDIANGTLF
PPVPDDRTFIAHGLNNRPTFFGCDVDNFTLSSSSTAPPLIVYLPNAPYTAWSNVTTFTPS
YSLAERNAIIRNGYNAATQGNGTLDEQWPVCVACAVLSRSLARTGTAVPDACRACFDRYC
WNGTVADATANVASGAGGEEYQPTFKIDNGSDDDTSAGAKVALAGSPAWAALFVGLVAAV
VML
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgagcgaccttctcccgctcgctctcctcccccactgcacatccgctgccgcc
ggggagcccgttattaagaggacagcagtacgcaatgatgacgtgaccatcagcgcacgg
gcgcgccccgacgcgcccgacggctatgcgccggccgtcgtgccgtgcccgcaggacaag
ccgaccatccggagcgccagctcgctctccaagagcgagagcgactggctggctaagcgc
cgcccgctcaccgtcgaacccatgatccagctcctcaagcgggccaacatcgaagggttc
gacgccgaggcctacatcaaccgggtcgccgatgacgtcaaggacctgcccaacatcggc
atcgccgtctcgggcggcggctaccgcgccctcatgaacggcgccggcttcatcgccgcc
gccgacagccgcaccccgggctcgaccgacaagggcggcatcggcggcctgctccaggcg
agcacctacctgtccggcctgtcgggcggcggctggctggtcagcagcatctatgccaac
aacttcaccaccgtcaccgccctgcgcgacggcagcgaggacagcagcgtctggaagttc
gacagctccatcttcacggggcccgacctgccgggcatcctcgacaccgcgaggtactgg
gccaaggtggccagccaggtcgcctccaagaaggacgccggcttcgagacctccatcacc
gactactggggccgcgccctgtcctggcagctcatcgacgcccccgacggcgggccctcg
tacaccttctccagcatcgccgacgacgacgacttctccaacgcccgcacccccttcccc
atcctggtcgccgacgagagggcccccggccagaagatcatctcgctcaacgccaccgtc
ttcgagttcaacccgtacgagatgggctcctgggaccccaccaccttcggcttcgccccc
atccgctacctggcctccaacttctcggccggcgtcgtcccgcgcgacggcaactgcgtc
cgcggcttcgactcgatcagctacatcttcggcaccagcagctccctcttcaacgccttc
ctgctccagaacatcacctcggtcgacggcgtgcccgacttcctcgtcgacgccgccacc
gccgtcctcgagggcatcagcgcggaagagaacgacatcgcccagtacgtgcccaacccg
ttcctgggctggaaccgccaggccaacccggccgccgagtccgactcgctcgacctcgtc
gacggcggcatggacctccagaacatccccctgcaccccttaatccagcccctccgcgcc
gtcgacgtcatcttcgccgtcgactcctccgccgacaccacctactcgtggcccaacggc
accgccatgcgcgccagctacgaccgctcccacggcgacatcgccaacggcaccctgttc
ccccctgtcccggacgaccgcacctttatcgcccacggcctcaacaaccgccccaccttc
ttcggctgcgacgtcgacaacttcaccctctcctcctcttccaccgctccccccttgatc
gtctacctgcccaacgccccttacacggcctggtccaacgtgacgaccttcacgccctcg
tactcgctcgccgagcgcaacgccatcatccgcaacggctacaacgccgcgacccagggc
aacggcaccctggacgagcagtggcccgtctgcgtcgcctgcgccgtcctgagccgctcg
ctcgcccgcaccggcaccgccgtccccgacgcctgccgcgcctgcttcgaccgctactgc
tggaacggcacggtggccgacgcgaccgcgaacgtcgccagcggcgccggcggcgaggag
taccagcccaccttcaagatcgacaacgggtccgacgacgacacgtccgccggcgccaag
gtcgccctcgcggggagccccgcctgggctgccctgttcgttggcttggtcgccgccgtc
gtcatgctgtga

DBGET integrated database retrieval system