KEGG   Myceliophthora thermophila: MYCTH_2296424Help
Entry
MYCTH_2296424     CDS       T02231                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mtm  Myceliophthora thermophila
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mtm00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(4335718..4336148,4336205..4337843,4337910..4338167))
Genome map
AA seq 775 aa AA seqDB search
MASTSTPQGTLRQRNVGVSTKKPKDGASSDVELDKLVKAAAEKSSKNSERDFKVVFVVMT
ALAFLTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPLGKLLFAFMGWLVGYDG
HFHFENIGDSYIVNKVPYVAFRSLPAILGALTVSVTYLIMWESGYSLPACIIAAGLILLD
NAHIGQTRLILLDATLVFAMACSLLCYIKFYKLRHEPFSRKWWKWLILTGFALSCDISTK
YVGLFAFITIGSAVVIDLWDLLDIKRPGGALTLAEFGKHFAARAFGLIIMPFLFYLFWFQ
VHFSILTRSGPGDDFMTPEFQETLSDNIMLANAVTIDYYDTILIKHKETKVYLHSHPDRY
PLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPGGADDQKLGRHVRNHDLVRLRHLGTDTI
LLSHDVASPYYPTNQEFTTVSIADAYGERAADTLFEIRIEHGKDGQEFKSVSSHFKLIHN
PSKVAMWTHPKPLPDWGYKQQEINGNKQIAPSSNVWLVEDIVSLPPDHKRREKPERKVKT
LPFLRKWFELQRSMFWHNNQLTASHPYASLPYQWPFLLRGVSFWTQNETRQQIYFLGNPV
GWWIASSVLAIYAGIVLADQFSLRRGIDALDHRSRSRLYNSTGFFFLAWATHYFPFYVMG
RQLFLHHYLPAHLASALVTGAIVEFIFAQDSLEHEVAYQAAKAGKKTGVQKRHLSARERF
AGQSMVASWIATVVILIAVAASWYFFLPLTYGYPGLSVDQVLRRKWLGYDLHFAK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgacatcgacgccccagggcaccctgcgacagcgcaatgtcggcgtctcgact
aagaaacccaaagatggcgcctcctcggatgttgagctcgataagctcgtgaaggctgcc
gccgagaagtcctccaaaaactctgagcgcgacttcaaggtcgtctttgttgtcatgact
gccttggccttcctcacccggttctggggcatcagccatcccaacgaggtcgtcttcgat
gaggttcacttcggcaagtttgcctcgtactacctcgaaaggacctacttcttcgacgtc
caccctccgctcggcaagcttctcttcgcctttatgggctggctggtgggctatgatggc
cacttccacttcgagaacatcggcgattcgtacatcgtgaacaaggttccttatgtcgct
ttccgctcgctgcccgccatcctcggcgccctgaccgtttccgtcacctacctgatcatg
tgggaatctggatacagtctcccggcttgcatcatcgctgctggcctgatccttctcgac
aatgcccacattggccagacacgcctgatcctgctcgacgccaccctcgtctttgccatg
gcctgcagcttactctgctacattaaattctacaagttgcgccacgagccgttctcgagg
aagtggtggaagtggctcatcctgactggcttcgcattgtcgtgcgatatctcgacgaaa
tatgtcggtctgtttgccttcatcaccatcggctcggctgtcgtcatcgacctctgggac
ctgctggacatcaagaggcccggaggcgccctcaccctggccgagttcggcaagcacttc
gctgcgcgtgcctttggcctgattatcatgcccttccttttctatctcttctggttccaa
gtccacttctccatcctcacccgctccggacccggcgacgacttcatgacccccgagttc
caggaaacgctcagtgacaacattatgctggccaatgccgtcaccattgattattacgac
accattctcattaaacacaaggagaccaaagtctatcttcacagccacccggatcgctac
cccctgaggtacgacgatggccgtgtctccagccagggccagcaggttaccggctatcct
ttcaatgataccaacaactactggcagatccttcctggcggcgccgatgaccagaagttg
ggccgccatgtcaggaaccacgacctcgtcaggcttcgccacctggggacagacaccatc
ctgctgtcccacgatgtcgcctccccgtactaccctaccaaccaggaatttaccaccgtt
tcgattgcggacgcctatggcgagcgggctgctgataccctgttcgagatccgcattgag
cacggcaaggatggccaggagttcaagagtgtttccagccacttcaagctcatccacaac
cccagcaaagtcgccatgtggactcaccccaagccgctccctgactggggctacaagcag
caggaaatcaacggaaacaagcagattgcaccgagctccaacgtctggctcgtcgaggac
atcgtgtccctcccgcccgaccataagcgtcgcgaaaaaccggagagaaaggtcaagacg
ctccccttcctccgcaagtggttcgagctgcagcgttccatgttctggcacaacaatcag
ttgaccgccagccatccctatgcgtcgctgccctaccagtggccgttcctgctacgcggt
gtcagcttctggacccaaaacgagacccgccagcagatctacttcctcggaaaccctgtc
ggatggtggatcgccagtagcgttttggccatctacgccggtatcgttctggctgatcaa
ttctcactgcgccgcggaattgacgccttggatcaccgctcgcgctctcgcctgtacaac
tcgaccggcttcttcttcctcgcctgggccacccactacttccccttctacgtcatgggt
cgccagctgttccttcatcactatctccccgcccacctcgcctctgccctagtgacaggc
gccatagtcgaatttatattcgcccaggactcccttgagcacgaagtggcataccaggcc
gccaaggccggcaagaagacgggcgtgcagaagcgccacctgagcgcgcgcgagcggttt
gccggccagagcatggtggcttcgtggatcgccaccgtcgtcatcctcatcgctgttgcc
gccagctggtacttcttcctgccactgacctacggctacccaggcctgtcggtcgaccag
gtcctgaggaggaagtggcttggctacgatttgcactttgcgaagtga

DBGET integrated database retrieval system