KEGG   Myceliophthora thermophila: MYCTH_2296527Help
Entry
MYCTH_2296527     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2296527
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2296527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4629405..4631387
Genome map
AA seq 660 aa AA seqDB search
MPDKALRVVTYAAGASLAAITLIYVFGPTYFLDGDTSRSGTGAFSTRKAGVVGLSNPAND
CFINSVLQALAGLGDLRLYLIREVHRRRLDDETVYTQLVPADALAQLEVETGLRRFGKDI
PGWKLEGLQRGVITKSLKDILDALNERPIHKKTISAAPFVRALEEAFRQRISRQQQDAHE
FLQIVAERLCDEYHAGCSARWLSRRTAALDEKKLAEAQQATQVPSAELPQSHRPLGQTNT
AALNQAAEASTGGAGQNRGYVEHQGMEEEEGFPLEGKFESQIECLTCGFKPRPTPSTFCT
LTLHVPRVPSTTLSACFDGMFKTEYIDDFRCEKCRLLHALSIFEVAARRASSEEKRLKAQ
SAAEKLRLAIEKDPETPPAGVELPDLHSAPKRRIARHIRITHFPKILAIHLSRSIFDASR
SSQKNLAKVAFPEKLTLGGLLQQRRYKLLGVVTHKGSHHSGHYESFRRQNIYPPFSNPST
FQASGVYSRTPSPASTPRADLRGQPPQDVAAPTSAGRHSDSAPPCHLSATPAAGSRDSLC
DSTRGGESSADARSGATPVAAAQASNSDSGSRDPTETTPQLSIPGAGSPPPRSGTPGAQS
VKEHRLSTHSAPAARTKQRKQQSRWWRISDDKIKEANTRDVLGMQREVYLMFYELERPYL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaaggcactcagggtcgttacctacgccgctggtgcctccctagcagcaatc
acgctcatttacgtgttcgggccgacgtactttctcgacggcgatacctcgaggtccggt
accggcgcattctcgacgcgaaaggcaggcgttgttggtctttcgaatcctgccaacgat
tgtttcatcaactcggttctccaggcactcgctggattaggcgacctccgactctatcta
atacgcgaagttcaccgtcgaagactcgatgacgaaaccgtctacacgcagttggtcccg
gccgacgcgctggctcagctggaagtcgagactggattaaggcgctttggcaaggatata
ccgggctggaagttggaagggttacaaagaggcgtcatcaccaagagcctcaaagatatc
ctcgacgcgttaaacgagcgcccgattcacaaaaagacgatatccgctgcaccttttgta
agggctctggaggaggctttccggcaacgcatcagccggcagcagcaagatgcccatgaa
tttctgcagatagtggccgagaggctctgcgatgagtatcatgcaggatgtagcgcacga
tggctctccaggcgcactgcggccctggatgaaaagaaactcgcggaggcgcaacaggca
actcaggttcctagcgcggaattgccccagtcgcatcggcctttgggccagacaaacacc
gctgctctcaaccaggcagccgaggcgtcgacaggcggcgcagggcagaatcgtggctat
gtggaacatcaaggtatggaagaggaggaaggtttccctttagagggcaagtttgaatca
caaatcgaatgcctaacttgtggtttcaaaccacgacctacaccctcgactttctgtacc
cttactctccatgtgcctcgggttccgtcaacaaccctgagcgcgtgcttcgacggcatg
ttcaagacggagtacattgacgacttcaggtgcgagaaatgccggcttctacatgcgctg
tccatcttcgaggtcgccgctcggcgagcttcctcggaggagaagagactgaaggctcag
tcagcggcggaaaagcttcggctcgccatcgagaaagaccccgagactcccccagcgggc
gtggaacttcccgatttgcactctgcgccaaagcgcaggatcgctcgccacatccgcatc
actcacttccccaaaatactggctattcatctgtccaggtccatctttgatgctagccgc
tcgtcgcagaagaacttggccaaggttgcattcccagaaaagctcacgctgggcggcttg
ctccagcaacgaaggtacaagttgcttggcgtcgtgactcacaagggaagtcaccacagc
ggtcactacgagtcctttcgacgtcaaaacatctacccgccgttttccaatccaagtacg
ttccaggcttcgggggtctatagcaggacccccagccccgcctcgacgcctcgggccgac
ctccggggccaacctccgcaggacgtcgctgctcccacctcggcgggaaggcattccgac
tcggctcctccttgtcacctatccgcgacccctgcggcgggctctcgcgactcgctgtgt
gatagcacgcgcggcggagaaagttccgcagacgctcggagcggtgccacaccggttgcg
gcggcgcaagccagcaattcggacagcggtagccgggatccgaccgaaacaacgccgcag
ttgagcatcccaggggctggctctccaccgccacgctccgggacaccgggtgctcaatcc
gtcaaggagcatcgactatcgactcactccgcgccagcggcaaggacgaagcagcggaag
caacagagtcgttggtggcgaattagtgacgacaagatcaaagaagccaatacccgtgac
gtcctagggatgcagcgggaggtgtacctaatgttctacgaactcgaacgaccctatctg
tag

DBGET integrated database retrieval system