KEGG   Myceliophthora thermophila: MYCTH_2296876Help
Entry
MYCTH_2296876     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MYCTH_2296876
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MYCTH_2296876
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: Other group
  TTK family
   MYCTH_2296876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(5158980..5159894,5159952..5161796))
Genome map
AA seq 919 aa AA seqDB search
MSPTPAERDGRQAAVGRRTSTRLVLRSQSAQYRNLDDSSDDEVLSPMKLSAITKALLGAG
HVSDASSSTNVPATGARHSPESLGSSIPAPVRATTGGDQESSWKRTRDSNNAPASQPPTP
PSGSHSRIGSRRGSIPAPVQPASRDQESPVQAARVTRHSRRGSTHSSRNPSPVGSRDNSP
APRKRVVRLNAPSSANGASGSRRNSLRNSFSSSSRGKQPESADGSRAKTASSPAAQQDRP
AKTPVLPVRTVRIAVGSSGQKPPSGASSDARPKYTTRSSEVEGRNASAAAIAPPIVAPQA
SLRVKRVGRTPGSFLSGPARRGRRRQSEDDADGPFEADAPGSGNEPGSQQAREEQQQEEE
VAPSAASEYPDFAASGSPVSAKDSARAALRRHRSTFITPVSQRKPEHHHLPLAFQDPSPP
APDSAEQDKENEGPSEIAPVIPASMRAANPPPSAINQRAPSQSVAPSNPEAVEPHGQAHG
APNNHVLTARSHNIPQRPAPPPPPKMSVVETATAAAGASTAAQASKKRQFLLRVNGKTYT
RIDSLGRGGSGKVYRVSAENGKLLALKRVSLENLDERTIKGYHGEIDLLQRLAGVNRVIQ
LIDHEFNAEKQTLSLVLEAGELDFNTFLRSRLSEDCRFDPVFVRYWWKEMVECVQAVHEK
DIIHTDLKPANFVLAQGRLKVIDFGIANAIQTDMTVNVHRDAQIGTPNYMSPESLMDFKE
YALTSAYNGQVNAPPLQRPKHFKLGKASDIWSLGCILYQMVYGQCPFAKITNMMARVNAI
KDWSHTIEFPEHTEHGVRVPPSLLRTMKRCLNRDQTQRPTCEELLCPTDPFLYPMELSSD
VFTAADHGKVIPITQELLRDVVWDVAQRVRRGDAADAEVLKLWPAAYWASCKKSLAMRSG
AGPGGAAASGNGAGAEKQH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaacgccagcagagagggacggccgccaggctgcggtggggaggaggacatcg
acaagattggttctccgtagccagtcagcgcaataccgcaaccttgacgacagctccgac
gatgaagtactcagtcctatgaagctgagcgccatcaccaaggcattgcttggtgctggt
cacgtctcagatgcgtcgtcttccaccaacgttccggccactggtgctcgccattcgccc
gaatcactggggagctcgattcctgcaccagtccgggcaaccacggggggggaccaggag
tcctcgtggaagcggacccgcgattccaacaacgcgcctgcctctcagcccccgacacca
cccagtgggtcacactcacgcattggttcgagaagaggctcgatccccgcccctgttcag
cctgcatccagggaccaggagtctcccgtgcaagcggcgcgcgtgactcgccattctcga
aggggcagcacccactcttccagaaacccgtcgccggtcggcagcagagacaacagtccc
gccccaaggaaacgtgttgtccgcctcaacgcgccgagttcggccaatggcgcaagcggg
agccgccggaatagtcttcgaaattctttttcgtcgtccagccgggggaagcaaccagag
agcgcagacgggtcgagggccaaaacggcttcgtccccggcggcgcagcaagatcgacca
gccaagactccggttcttccagtgaggacagtcaggatagccgtcgggtcgtcggggcag
aaaccgccgtcaggtgcctcgtctgatgcacgtcccaagtacaccacacggtcctcggaa
gtcgagggccggaatgcctccgcagcggccattgcgccacctattgtggctccccaggcc
tccttgcgagtcaagcgagtcgggaggactccaggaagctttttgtcgggacctgctcgc
cgcgggcgccggaggcagagcgaggatgacgctgatggcccgtttgaggccgatgcacct
ggctcgggcaacgaaccaggtagccagcaagctcgggaggagcagcagcaggaggaggag
gtcgcgccatcagccgcttctgaatatcccgatttcgccgcttctggcagtcctgttagc
gcaaaagactcggccagagccgcccttcgtaggcacaggtcgacctttatcacgcccgtg
agccagaggaaaccggaacaccatcatctgccgttggccttccaagacccgtcccctccc
gcgcccgattctgccgaacaggacaaggaaaacgagggcccctccgagatcgcgcccgtg
attcctgcctctatgcgggcggctaatcctccgccctcggcgataaatcagcgagcaccg
tcgcagtccgtcgcgcctagcaacccggaggccgtcgagcctcacggccaagctcatggc
gctccaaataaccatgttctgactgcgaggtctcacaacattccccagagacccgccccg
ccacctccaccaaagatgtcggttgtcgaaacggccactgctgctgcgggcgcttccacc
gccgcgcaagccagcaagaagaggcagttcttgcttcgtgtcaacggcaagacgtacacg
aggatcgactcccttggtcgcggcgggtccggtaaggtctaccgcgtctcggccgaaaac
ggaaagctgctggccctgaagcgagtgtctctcgagaacctggacgagaggaccatcaag
ggctaccacggcgaaatcgacttgttgcagcggttggcgggagtcaaccgagtcatccaa
ctaatcgaccatgaattcaacgccgagaagcaaaccctgagccttgtgctggaagctggc
gagcttgattttaacactttcctccgcagccgcctatcggaggattgccggttcgacccg
gtttttgtccggtactggtggaaggaaatggtcgagtgtgtgcaggcagtgcatgagaag
gatatcatccacacagacctgaaaccggccaacttcgtgcttgcccaaggccgactcaag
gtcattgactttggcatcgctaacgccatccaaaccgatatgacggttaatgttcaccgc
gacgcccagatcggcaccccgaactacatgtctccggagtcgttgatggatttcaaagag
tacgctctcacctcggcctacaatgggcaggtcaacgcgccaccgttgcagcggcccaaa
cacttcaaactcggcaaggccagcgacatatggagtctcggctgcatcctgtaccagatg
gtgtacgggcaatgccccttcgcaaagatcaccaacatgatggcccgcgtgaacgcgatc
aaagactggtcacacacaatcgagttccccgagcacacggagcacggcgtccgggtgccg
ccgagcctcctccgcaccatgaagcgctgcctcaaccgcgatcagacgcagcggccgaca
tgcgaggagctgctctgcccaaccgatcctttcctctatccgatggaactgtcgagcgat
gtctttaccgctgccgaccacggcaaggtgatcccgatcacccaggaactgttgcgcgac
gtggtctgggacgtggcgcagcgtgttcggcgcggagacgccgcggatgccgaggtgttg
aagctgtggccggcagcgtattgggctagttgcaagaaatcgctggccatgcggagcggg
gccggaccaggtggagctgctgccagtggcaatggtgcaggtgctgagaaacagcattaa

DBGET integrated database retrieval system