KEGG   Myceliophthora thermophila: MYCTH_2297133Help
Entry
MYCTH_2297133     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mtm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:5761592..5762713
Genome map
AA seq 373 aa AA seqDB search
MDEATLAENFADSAYHCEHHNMDLNSVGKFGLSTLPREHGFKVVLTGEGSDEHFSGYPFF
LQDMLREPDLATPDSALSKDDELRERYREMAQKGLGEVMLARAGAFRHRPLGDEAFRDLN
GARLLDALQLWQPMLGVFAPWVQERWPGTSVQLALANQMPPAAKEKMATKWHPLHTSHYL
WIRTMLANNLLTCLGDRTEMAHSIEARPPFLDHVLSEYVNALPPSVKWAYTPDAEERNRL
PWAGGNTKAGNTKAVTTFFSEKWILREAGKPYITKELYERKKHPYVAPNRWPKDGPLHKK
LREICTEEAVGKLGFVDWEVVKGALDRAFGEDGDPMAFRILLVVGGWVSIGQRFGVKRAE
PKAETNGILNGKV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggccacgctggccgagaactttgccgactcggcgtaccactgcgagcaccac
aacatggacctcaacagcgtcggcaagtttggcctatctaccctcccgcgcgagcacggc
ttcaaggtcgtgctgaccggcgagggctccgacgagcacttctccggctaccccttcttc
ctgcaagacatgctgcgcgagcccgatctcgccacccccgactcggccctgtccaaggac
gacgaactgcgcgagcggtacagggagatggcccagaagggtctcggggaggtcatgtta
gctcgtgccggcgcgttccggcaccggccgctcggcgacgaagcgtttcgcgacctgaac
ggcgccaggctgctggacgcgctgcagttgtggcagccgatgctcggcgtcttcgcgccg
tgggtgcaggagcggtggcccggcaccagcgtccagctggccctggcaaaccagatgccg
cccgcggccaaggagaagatggcgaccaagtggcaccccttgcacacgtcgcactacctc
tggatcaggacgatgctggccaacaacctgctcacctgcctgggcgaccgcaccgagatg
gcgcacagcatcgaggcgcgcccgcccttcctggaccacgtgctgtccgagtacgtgaac
gcgctgccgccgagcgtgaagtgggcgtacaccccggacgccgaggagcgcaaccggctg
ccctgggccgggggcaacaccaaggccggcaacaccaaggccgtcaccaccttctttagc
gagaagtggatcctccgcgaggccgggaagccgtacatcaccaaggagctgtacgagcgc
aagaagcacccgtacgtggcgccgaaccgatggcccaaggacggaccgctgcacaagaag
ctgagggagatctgcaccgaagaggcggtgggcaagctgggattcgtcgattgggaagtt
gtaaagggagcgctggacagggcctttggcgaggacggtgaccccatggcctttaggatc
ttgcttgtcgtcggcggctgggtgtcgataggccagcgctttggcgtcaaacgggccgag
ccgaaagccgaaaccaacggaatcttgaatggaaaggtctga

DBGET integrated database retrieval system