KEGG   Myceliophthora thermophila: MYCTH_2297347Help
Entry
MYCTH_2297347     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mtm  Myceliophthora thermophila
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:mtm04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6200891..6202489,6202566..6202976)
Genome map
AA seq 669 aa AA seqDB search
MAGHHDNTDPTTPADEYDPSNPTSPGSLGDDSEASTPLDIPSSSSDAQPSPSPAELPRRL
PSLRTVSDPQNSSHMSPTSSVTGLLNTARRPTPSASSLPFDIMQRARALQEQRMNMAARS
SPSAGNLNMGSIGRQMNVGGPSAGGLAGGMPSNLKMPGGVSRPLPPAFPKSAPSVPGSKK
PPSLSERRAMKLGNLPGQGASSPAAAPPKLRDLGDDAENQPSLNGEGRGSKLSDFKNYID
ADKGWITFDGAATITGTGVNFANGQTFSISLDEVDVLDELGKGNYGTVYKVRHARPKVPR
FGQGLSKFRPSVSSQSSNETDESPNDTPSSGASGGSRATSGVIMAMKEIRLELDEAKFTT
ILKELVILHECVSPYIIDFYGAFFQEGAVYMCIEYMDGGSIDKLYAGGIPENVLRKITFA
TIVGLKTLKDDHNIIHRDVKPTNILVNTNGQVKICDFGVSGNLVASIAKTNIGCQSYMAP
ERISGGALAAGAASGTYNVQSDIWSLGLTIIECAMGKYPYPPEVSSNIFSQLSAIVEGDP
PDLPSDGYSALAQDFVRCCLNKNPHKRHTYPMLLAHPWIKSLGKPETITEDAEAEEAAAD
DALADATGSLSLNNPSGQVREGDYEVAEWVKAVLQRKRDGLLKEEAKKPALHAAPLDTLS
PMASPLGER
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggccggccatcacgacaataccgaccccaccacgccggcggatgagtatgacccgagc
aacccgacctcgccgggctcgcttggcgacgactcggaggcgagcacgcccctcgacatc
ccaagttcgagctccgacgcgcagcccagtccttctcccgccgaactgccccgccggtta
ccgtcgttgagaacagtctcggacccgcaaaactccagccatatgagccctacctcgagc
gtcaccgggcttctgaacacggcgaggagaccgacccctagcgcatcgagcctgccgttt
gatatcatgcagagggcgcgggcccttcaagagcagcgcatgaacatggcggcccggtcc
agcccttctgcagggaacctgaacatgggtagtataggcaggcagatgaacgtgggagga
cccagcgccggcgggctagccggcggcatgccgtccaacctcaagatgccgggaggcgtg
tcccggcccttgcctcctgcgttcccgaagtcggctccctcagtcccaggctcgaagaaa
cccccaagcctgagcgagaggcgggccatgaagctaggcaacctccccggacaaggggcc
tcttcacctgctgccgccccaccaaagttgcgggatcttggagacgacgcggaaaaccag
ccgtcactgaacggggaaggccggggctccaaactgagcgacttcaagaactacatcgat
gcagacaagggctggatcacctttgacggcgcagcgaccatcacaggaacaggggtcaat
tttgccaacgggcagacgttctccatctcgcttgacgaggttgacgttctggacgagctc
ggcaagggcaattacggcaccgtgtacaaggtcaggcacgccaggccaaaagtaccgcgg
ttcggccaaggattgagcaaatttcggccgtcggtttcctcgcaatcctctaacgagaca
gacgagtcacccaacgatacaccatcaagcggcgcctctggcgggagcagggcgacgtca
ggcgtgatcatggccatgaaggagattcggctggaactcgacgaagccaagttcaccacc
attctcaaagaactcgtcattctccacgaatgtgtatcgccctacatcattgacttttac
ggtgccttcttccaagaaggcgcggtgtacatgtgcatcgagtacatggacggcggcagc
attgacaagctgtacgcgggcgggataccagaaaacgtgctccgcaagatcaccttcgcc
accattgtcggcctcaagacgcttaaggacgaccacaacatcatccaccgcgacgtcaag
ccaaccaacatcctggtaaataccaatgggcaggtcaagatttgcgactttggcgtgtcg
ggcaacctggtagcgagtatcgccaagaccaacattggctgtcagagctacatggcaccc
gagcgcatcagcggcggcgcgctggccgcgggcgccgcctccgggacgtacaacgtgcag
agcgacatctggagtctgggtctgaccatcatcgagtgcgccatgggcaagtatccttac
ccgcccgaggtatccagcaacatcttcagccaactgagcgccatcgtcgaaggtgacccc
cccgacctcccctccgacggctactcggccctcgcccaagactttgtccggtgctgcctc
aacaagaacccgcacaagcggcacacctacccaatgctgctcgctcacccgtggatcaag
tctctcgggaagcccgagacaatcaccgaagatgccgaggccgaggaggctgccgctgac
gacgccctcgccgacgccacgggctcgctgagcctaaataatccttcgggccaggtgcgc
gaaggggactacgaggtggccgagtgggtcaaggccgtgctgcagcgcaagcgagacgga
ctcctgaaggaggaggcaaaaaagccggcgctgcatgccgcgcctctggatacccttagc
cctatggctagcccgctaggagagcgctga

DBGET integrated database retrieval system