KEGG   Thermothelomyces thermophila: MYCTH_2297482Help
Entry
MYCTH_2297482     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm04136  Autophagy - other
mtm04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    MYCTH_2297482
   04136 Autophagy - other eukaryotes
    MYCTH_2297482
Membrane trafficking [BR:mtm04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    MYCTH_2297482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Raptor_N BBS2_Mid HEAT_2 Cnd1 Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 11513354
NCBI-ProteinID: XP_003659918
JGI: 2297482
UniProt: G2Q5Z6
Position
1:complement(join(6442201..6442411,6442477..6445159,6445237..6446176,6446438..6447022))
Genome map
AA seq 1472 aa AA seqDB search
MTAISLDVPQPAQLGRGQASAQFSRAATLAASSPSRHPGSFSRQTTHAMSYLQAQYAEAS
ASTSAAASSSQSNKNMNGASSAHAPALAPARPGQPLANDRPVTSPTPASTHRPSSAPGDN
QVAVPNNRADSGPVEGNRSAATRPAKPPLLRSKSEHRPRFDEADDNVEEEYYDLGARHGF
EDHYLSEDIIAQLANNWYMYFTDKRHETTGKPKSPAFELQDWRMRDRLKTVSAAIAVCLN
IGVEPPDQLRTTPGAKLEAWQDPTVPPVGKALENIGKALQAQYENLALRTRYKQYLDPSI
EETKKFCISLRRNAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQQWLQ
APTIFVWDCSEAGNILRNYHKFVEKHEQEEEEQMLKDPNHEKTNYRPYIHLAACDSKENL
PTNPLLPADLFTCCLTTPIEMALWFFVLQNPLKTNITPERARKLPGRLQERRTPLGELNW
IFTAITDTIAWTTLPRPLFRKFFRQDLMVAALFRNFLLAQRIMPVYGCTPKSYPELPDTR
RHPLWESWDLAVDMALAQLPMLERREQEGIPYEYVNSTFFTEQLTAFEIYLTRGDAVSQK
PPEQLPVVLQVLLSQQHRLRALILLGRFLDLGPWAVQLALSIGIFPYVLKLLQSAAQELK
PVMVFIWTRVLAVDISCQQDLIKDNGYTYFAAIMKPQETFPVVGVVVLDEHKAMCAFILA
MLCKGFKPGQIVCNSTDIMTYCLHHIEHPENPLLRQWSCLCISQLWSDLPDAKWRGIREN
AHHKLSYLIKDHCPEVRAAMAHAMTTFLGIPDLTDEVARIEEGIAWAMLELATDSSPIVR
KELLVFFSHFVLRYENKFLVAAYEQLLEEKEYQLFPPPEDGLDHKMGLHYARRENRERDG
TISPSAFGVAHDSVFAACWKHINILSVDPHPEVQRDATIIMDYVHHALLHSPVGAQAQSL
MDEILRRSRKVSRGDTSQRTTVAGSRTAAAQPMPSPGLLKRTASYLFGPLMGTLDASSNA
PTLPATPGLQRSFSQRSWKGPSLENAPPEQHDQAAPPSNYHVANEPLCAGYKERDPKETP
TLPLVSTFLEWSTEYFREPQMKAPEAEEPGSNEYNERLWRRSRNEAVLRETQPQKTYART
HRWNSQAGVIVTGSQPSKMTFHQFENHIAVADDGNTVTILDWKTNTRKSRFSNGNPEGSK
ISDMRFINEDDQALLMTGSSDGVIRVYNKYDSDEGVELASSWRALTHMVPSNVNSGMVFE
WQQVNGQVLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDGA
VRVFDTRLKPQESMVRKWKDENRQWVRSVHMQRGGQRELLSASRNGKVNLWDIRMEQPLK
TFQTTKDVLRTASTHEHLPVFAIGTSAHLVKVFDFDGHEITRLEPYSGFLGHKAAPLAAT
AFHPHRMLLGCAARGDNHVSLYTCGNERVGPF
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgacggccatttccctcgacgtgccgcagcctgcccaactcggccgagggcaggcctcg
gctcaattctcgagagccgccactcttgccgcgtcctcaccgtcccgacatcctggctcc
ttctctcgacagacgacgcacgccatgtcgtatctccaggcccagtacgccgaagcgtcg
gcatcgacatcggcagcggcatcatcgtcgcaatccaacaagaacatgaatggtgcttct
tcggcgcatgctcccgcgctcgctccggcgcggccgggacagccgctcgcaaatgacaga
ccggtcacgtccccgacccccgcctccacgcaccgcccgtccagcgcccctggggacaat
caggttgcggtcccaaacaaccgtgccgattccggaccagtcgaaggaaatcgctctgct
gccacgaggccagccaaacctcctttgcttcgatccaagagtgagcaccgcccgcgtttt
gacgaggccgacgacaatgttgaggaagagtactacgacctgggcgccaggcatggattc
gaggaccattacctgtctgaagacatcatcgctcaactcgccaataattggtacatgtat
ttcaccgacaaacgccatgagacgacggggaagcccaagtcaccggccttcgaacttcag
gactggcgaatgcgcgatcggctcaagacggtttcggctgccattgccgtctgcctgaac
attggcgttgagcctccagaccagctgcgaaccacacccggagccaagctagaggcctgg
caggacccaaccgttccgccagtcggcaaagcgttggaaaacattggcaaagctctgcag
gctcaatacgagaacctcgccctccgaactcgctataagcaatacctcgacccgtcgatc
gaggagaccaagaagttctgcatatcccttcgccggaacgccaaggatgaacgagttctc
ttccactataacgggcatggagtgcccaagccgaccgcttctggcgagatctgggtcttc
aacaaaaactatacccagtatatcccggtttcgctatatgaccttcagcagtggctccag
gctcccacgattttcgtttgggattgctccgaggcggggaacatcctcagaaactaccac
aagttcgtcgagaaacatgagcaagaagaggaggagcagatgctcaaggatccgaatcat
gagaagacgaattaccgcccctacatacatctggcggcctgcgactccaaggagaaccta
ccgacgaatcccctgctgccagccgatctctttacttgctgcttgaccacgccgattgag
atggctctttggttctttgtactacagaacccgctcaaaaccaatatcacccctgagaga
gctcggaagctcccgggaaggctccaggaacgacggacgcccctgggagagctgaactgg
atcttcacggccattacggataccatagcctggacaactctcccgcgtccgctgtttcgc
aagttcttccgacaagacttgatggtggcggctctattccgcaacttcctcttggcacag
cgcatcatgccagtctatgggtgtactcccaagtcctaccctgagctgccggacacccgc
cggcacccgctctgggagagctgggacctcgcggttgacatggcgctcgcgcaactcccc
atgctggaacggagggagcaagagggcatcccgtacgagtacgtcaactcgaccttcttc
acagaacagctcacagctttcgagatctacttgacaaggggggatgccgtctcgcagaag
cccccagagcaacttcccgtggtcctccaagtcctcctcagccagcagcatcgactacga
gccttgatcctcttgggcagattccttgacctcggcccctgggcagtacagctggcactg
agcataggcatctttccttacgtgctcaaattgctgcaatcggccgcgcaagaactcaag
ccagtcatggttttcatctggactcgcgtgctggctgtcgacatctcgtgccagcaagac
cttatcaaggataacggctatacctattttgcggctataatgaagccacaagagacgttc
ccggtcgttggcgttgtcgtcctggacgaacacaaggccatgtgcgcgttcatcttggcg
atgctctgcaagggcttcaagcccggtcagattgtctgcaactcaaccgacatcatgacc
tactgccttcatcatattgagcaccccgagaatcctctactacgtcaatggtcctgtctc
tgcatcagtcagctttggagtgatcttcccgatgcgaagtggaggggcatccgggagaac
gctcaccataagctttcctacctcattaaggatcactgccccgaggttcgcgccgcgatg
gcgcacgccatgaccacgtttcttggcatccccgacctcaccgatgaagtggccaggatt
gaagagggtattgcttgggccatgctagagctggctacggacagcagccctatcgttcgg
aaagaactacttgtcttcttttcacactttgttctccgctacgagaataagttcctcgtt
gctgcctacgagcaacttcttgaggagaaggagtaccagctcttccctcccccggaggac
ggattggaccacaaaatgggtctccattacgcgcggcgcgagaaccgtgagcgggacggc
accatctcgcccagtgcgtttggcgtggcccacgattcggtgtttgcagcatgctggaag
cacatcaacatcctgagcgtcgatccccacccggaggtacaaagggacgccaccataatc
atggactatgtccaccacgcgctgctgcactctcctgtgggcgctcaagcgcagtctctg
atggacgagatccttcgccgctctaggaaagtgtcgagaggcgacacgagccagaggacc
accgtggcgggcagccgtaccgcggcggcgcagccgatgccgtctcccggacttctcaag
cggaccgcaagctacctttttggtccccttatgggaacgctggacgcatcctccaatgct
ccaacactccccgcaactcccggattgcaaaggtcattctctcagcgaagttggaaggga
ccgagcctcgaaaacgcaccaccggagcagcacgaccaggctgcgccgccatcaaactat
catgttgcgaacgagccgctctgtgcgggttacaaggaacgcgaccccaaggagacgccc
acccttcccctggtcagcacttttctggaatggtcaaccgagtacttccgagaacctcaa
atgaaggcacccgaggcagaagaaccaggaagcaacgagtacaatgagcggctctggcgg
cggtctcgcaacgaagctgttcttagagagactcagcctcaaaaaacatacgccaggaca
cacagatggaatagtcaggcgggagtcatcgtaactggctcacagccgtcgaagatgact
ttccaccaatttgaaaaccacatcgcggttgccgacgatgggaacactgtcaccatcttg
gattggaagaccaatacccgcaagagccgcttctcgaacggcaatccagaaggttccaag
atctccgacatgcggttcatcaacgaggacgaccaggcactcctcatgaccggttcatcg
gatggcgtcatccgtgtttataacaagtacgacagcgatgagggcgtggagcttgcatct
tcgtggcgcgcattaacccacatggttccttccaatgtcaactccggcatggtgtttgag
tggcagcaggtcaacggtcaggtgctggtggccggcgatgagcgagtcatccggatttgg
aacgcgggccacgagatgtgcacacacgaaatcccagcgcgatcgggctcctgcgtgacg
tcgctgacgtcggatcagatgacgggcaacatcttcgtcgcaggcttcggtgacggcgcc
gtccgcgtcttcgacacgcgcttgaagccgcaggagtcgatggtccgcaagtggaaggac
gagaacaggcagtgggtgcgctcggtgcatatgcagcgcggcggtcaacgtgagctactg
tctgcgagccgcaacggcaaggtgaacctctgggatattcgcatggagcagcccctcaag
acgttccagacaaccaaggacgtgctccgaacggccagcacgcatgagcatttacctgtg
tttgccatcggtacttctgcgcacctcgtcaaggtgttcgactttgatgggcatgaaatc
actcgcctagagccctattcagggttcctgggccacaaagctgccccgcttgcggccact
gctttccacccgcaccgtatgctcctaggttgtgccgcccgcggcgataaccatgtcagc
ctgtacacttgtggcaacgagcgggttgggccgttctga

DBGET integrated database retrieval system