KEGG   Myceliophthora thermophila: MYCTH_2297503Help
Entry
MYCTH_2297503     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mtm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mtm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mtm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mtm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6480451..6481164,6481253..6481720,6481780..6482955)
Genome map
AA seq 785 aa AA seqDB search
MAAKKKIAIMTSGGDSPGMNGVVRACVRMAIHLGCDAYCVYEGYEGLVRGGDLIRQMHWH
DVRGWLSEGGTLIGTARCMAFYERAGRLAAARNLISHGIDALIICGGDGSLTGADRFRAE
WPSLIQELEDTGEYTALELEPYRHLNIVGLVGSIDNDLSGTDATIGCYSALARICHAVDL
IEATASSHSRAFVIEVMGRHCGWLALMAGVATGADFIFIPEKPREDNWREEMCGIVEHHR
KLGKRKTIVIIAEGAIDREGNKITPEMVKDLLADKNGLGLDTRITTLGHVQRGGTAVAYD
RMLATLQGVEAVKAVLEAKPDTPTCVITINENKIVRKNLMEAVKETKMVAKAIENQDFDR
AMGLRDTEFSEQYRSFMMTTAVQIDHKMLLPEKERMKIGFINVGAPAGGMNAAVRAGVAY
CLSRGHEPVAIYNGFAGFARHHDDKPLGAVRPFDWLEVDGWASKGGSEIGTNRELPSESG
MEKIADLIELYQFDALFLIGGFEAFHAVCQLRKARDQYPSLCIPITLLPATISNNVPGTE
YSLGSDTCLNELVEYCDKIKQSASATRRRVFVIETQGGRCGYVATLAGLGVGASAVYTPE
EGLSLEMLAADVRHLKSVFAKDQGQSRAGRLILINEKASRVYNARLIAEILREEAHGRFE
SREGIPGHMQQGGVPSPMDRCRAVRLAIRCIQHLEQFGRSVHNRVKNDPMSATVIGIKGA
SVVFTPVKQVEEEETDWPNRRPKKVFWKDIGEICDILSGRPKHELPEPDLKGLKAKDVKR
GIETL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaaaagaagatcgccatcatgacgtcgggcggagattcgcccggcatgaac
ggcgtcgtgcgcgcttgcgtccggatggccatccacctgggctgcgatgcctactgcgtc
tacgagggttacgagggtcttgttcgcggcggcgatttgatacggcagatgcactggcac
gacgtgcgcggatggctgtccgagggcggcactctgatcggcaccgcccgctgcatggca
ttctacgagcgcgccggccgtctggccgccgccagaaatctgatctcccacggcatcgat
gcgctcatcatctgcggcggagatggctcgctcaccggagccgataggttccgcgccgaa
tggccgtcgctcatacaggaactcgaggacaccggcgagtacaccgccctcgaactcgaa
ccctaccgccacctcaacatcgtcggcttggtcgggtccatcgataatgacctttccggg
acggacgctacgatcggctgctactcggctcttgcgcggatctgccatgccgtcgatctc
attgaggccaccgcttcctcccactcgcgggctttcgtgattgaggtgatggggagacac
tgcggatggctggcgttgatggctggcgttgctacgggtgcggattttatcttcattccg
gagaagcctagagaggacaactggagggaggagatgtgcggtatcgtcgaacaccaccgg
aaactcggaaaacgcaagaccatcgtcattatcgccgagggcgccatcgacagggagggc
aacaagatcactcccgagatggtgaaggatctgctggccgacaagaatggcctcggcctc
gacacccggatcacgaccctcggccacgtccagcgtggcggaactgccgtcgcgtacgac
cggatgctggcaacgctccagggagtcgaggccgtaaaggctgttctggaagccaagcct
gacacgcctacgtgcgtcatcaccatcaacgagaacaagatcgtcaggaagaacctcatg
gaggctgtgaaggagacaaagatggtggccaaggcgatagaaaatcaggattttgaccgg
gccatggggctccgggataccgaattctcggagcagtacaggtcctttatgatgacgacg
gcggtccagattgaccacaagatgttgctaccagaaaaagagcgcatgaaaatcggcttc
atcaatgtcggcgccccagccggcggcatgaacgccgcggttcgcgccggcgtagcgtac
tgcctgtctcgcggtcacgagccggtcgccatctacaacggattcgccggattcgcccgc
caccacgacgataagccgctgggagcggttcggccgttcgactggctcgaagtcgatggc
tgggcaagcaagggtggttcggagatcggaacgaaccgcgagcttcccagcgagtcgggt
atggagaagatcgccgatctgatcgagctctaccaatttgacgctctcttcctcattggt
gggttcgaagcgttccatgccgtctgccagctgcgcaaggccagggaccagtacccttcc
ctgtgcatccccatcacgctgctgcctgctaccatctccaacaacgtgccggggaccgag
tactcccttggctcggacacgtgcctcaacgagctggtcgaatactgcgacaagatcaag
cagtccgcttcggccactcggcgccgcgtcttcgtcatcgaaacccagggcggccgctgc
gggtacgtcgctacgctcgccggtctcggcgtgggcgcctcggccgtctacacgcccgag
gagggcctcagcctcgagatgctcgcggccgacgtgcgccacctcaagtccgtgtttgcc
aaggaccagggccagtcccgcgccggccggttgatcctcatcaacgagaaggcctccagg
gtctacaacgcccgcttgatcgccgagatcctccgagaagaggcccacggccggttcgag
agccgcgagggcatcccgggccacatgcagcagggcggtgtgccctcgcccatggaccgg
tgccgcgcggtgcgcctggccatccggtgtattcagcacctggagcagttcggccgcagc
gtgcacaatcgtgtcaagaacgaccccatgagcgccaccgtcatcggcatcaagggcgcc
agcgtcgtcttcacaccagtaaagcaggtcgaggaggaggagaccgactggcccaaccgc
cgtcccaaaaaggtcttctggaaggacattggggagatctgcgatatcctgtccggtagg
cccaagcacgagctaccggagccggacctcaaggggctcaaggctaaggatgtgaagagg
gggatcgaaaccctttaa

DBGET integrated database retrieval system