KEGG   Myceliophthora thermophila: MYCTH_2297503Help
Entry
MYCTH_2297503     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2297503
   01230 Biosynthesis of amino acids
    MYCTH_2297503
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2297503
   00030 Pentose phosphate pathway
    MYCTH_2297503
   00051 Fructose and mannose metabolism
    MYCTH_2297503
   00052 Galactose metabolism
    MYCTH_2297503
  Energy metabolism
   00680 Methane metabolism
    MYCTH_2297503
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MYCTH_2297503
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYCTH_2297503
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYCTH_2297503
Messenger RNA biogenesis [BR:mtm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MYCTH_2297503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6480451..6481164,6481253..6481720,6481780..6482955)
Genome map
AA seq 785 aa AA seqDB search
MAAKKKIAIMTSGGDSPGMNGVVRACVRMAIHLGCDAYCVYEGYEGLVRGGDLIRQMHWH
DVRGWLSEGGTLIGTARCMAFYERAGRLAAARNLISHGIDALIICGGDGSLTGADRFRAE
WPSLIQELEDTGEYTALELEPYRHLNIVGLVGSIDNDLSGTDATIGCYSALARICHAVDL
IEATASSHSRAFVIEVMGRHCGWLALMAGVATGADFIFIPEKPREDNWREEMCGIVEHHR
KLGKRKTIVIIAEGAIDREGNKITPEMVKDLLADKNGLGLDTRITTLGHVQRGGTAVAYD
RMLATLQGVEAVKAVLEAKPDTPTCVITINENKIVRKNLMEAVKETKMVAKAIENQDFDR
AMGLRDTEFSEQYRSFMMTTAVQIDHKMLLPEKERMKIGFINVGAPAGGMNAAVRAGVAY
CLSRGHEPVAIYNGFAGFARHHDDKPLGAVRPFDWLEVDGWASKGGSEIGTNRELPSESG
MEKIADLIELYQFDALFLIGGFEAFHAVCQLRKARDQYPSLCIPITLLPATISNNVPGTE
YSLGSDTCLNELVEYCDKIKQSASATRRRVFVIETQGGRCGYVATLAGLGVGASAVYTPE
EGLSLEMLAADVRHLKSVFAKDQGQSRAGRLILINEKASRVYNARLIAEILREEAHGRFE
SREGIPGHMQQGGVPSPMDRCRAVRLAIRCIQHLEQFGRSVHNRVKNDPMSATVIGIKGA
SVVFTPVKQVEEEETDWPNRRPKKVFWKDIGEICDILSGRPKHELPEPDLKGLKAKDVKR
GIETL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaaaagaagatcgccatcatgacgtcgggcggagattcgcccggcatgaac
ggcgtcgtgcgcgcttgcgtccggatggccatccacctgggctgcgatgcctactgcgtc
tacgagggttacgagggtcttgttcgcggcggcgatttgatacggcagatgcactggcac
gacgtgcgcggatggctgtccgagggcggcactctgatcggcaccgcccgctgcatggca
ttctacgagcgcgccggccgtctggccgccgccagaaatctgatctcccacggcatcgat
gcgctcatcatctgcggcggagatggctcgctcaccggagccgataggttccgcgccgaa
tggccgtcgctcatacaggaactcgaggacaccggcgagtacaccgccctcgaactcgaa
ccctaccgccacctcaacatcgtcggcttggtcgggtccatcgataatgacctttccggg
acggacgctacgatcggctgctactcggctcttgcgcggatctgccatgccgtcgatctc
attgaggccaccgcttcctcccactcgcgggctttcgtgattgaggtgatggggagacac
tgcggatggctggcgttgatggctggcgttgctacgggtgcggattttatcttcattccg
gagaagcctagagaggacaactggagggaggagatgtgcggtatcgtcgaacaccaccgg
aaactcggaaaacgcaagaccatcgtcattatcgccgagggcgccatcgacagggagggc
aacaagatcactcccgagatggtgaaggatctgctggccgacaagaatggcctcggcctc
gacacccggatcacgaccctcggccacgtccagcgtggcggaactgccgtcgcgtacgac
cggatgctggcaacgctccagggagtcgaggccgtaaaggctgttctggaagccaagcct
gacacgcctacgtgcgtcatcaccatcaacgagaacaagatcgtcaggaagaacctcatg
gaggctgtgaaggagacaaagatggtggccaaggcgatagaaaatcaggattttgaccgg
gccatggggctccgggataccgaattctcggagcagtacaggtcctttatgatgacgacg
gcggtccagattgaccacaagatgttgctaccagaaaaagagcgcatgaaaatcggcttc
atcaatgtcggcgccccagccggcggcatgaacgccgcggttcgcgccggcgtagcgtac
tgcctgtctcgcggtcacgagccggtcgccatctacaacggattcgccggattcgcccgc
caccacgacgataagccgctgggagcggttcggccgttcgactggctcgaagtcgatggc
tgggcaagcaagggtggttcggagatcggaacgaaccgcgagcttcccagcgagtcgggt
atggagaagatcgccgatctgatcgagctctaccaatttgacgctctcttcctcattggt
gggttcgaagcgttccatgccgtctgccagctgcgcaaggccagggaccagtacccttcc
ctgtgcatccccatcacgctgctgcctgctaccatctccaacaacgtgccggggaccgag
tactcccttggctcggacacgtgcctcaacgagctggtcgaatactgcgacaagatcaag
cagtccgcttcggccactcggcgccgcgtcttcgtcatcgaaacccagggcggccgctgc
gggtacgtcgctacgctcgccggtctcggcgtgggcgcctcggccgtctacacgcccgag
gagggcctcagcctcgagatgctcgcggccgacgtgcgccacctcaagtccgtgtttgcc
aaggaccagggccagtcccgcgccggccggttgatcctcatcaacgagaaggcctccagg
gtctacaacgcccgcttgatcgccgagatcctccgagaagaggcccacggccggttcgag
agccgcgagggcatcccgggccacatgcagcagggcggtgtgccctcgcccatggaccgg
tgccgcgcggtgcgcctggccatccggtgtattcagcacctggagcagttcggccgcagc
gtgcacaatcgtgtcaagaacgaccccatgagcgccaccgtcatcggcatcaagggcgcc
agcgtcgtcttcacaccagtaaagcaggtcgaggaggaggagaccgactggcccaaccgc
cgtcccaaaaaggtcttctggaaggacattggggagatctgcgatatcctgtccggtagg
cccaagcacgagctaccggagccggacctcaaggggctcaaggctaaggatgtgaagagg
gggatcgaaaccctttaa

DBGET integrated database retrieval system