KEGG   Myceliophthora thermophila: MYCTH_2297591Help
Entry
MYCTH_2297591     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCTH_2297591
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     MYCTH_2297591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6597808..6597910,6598152..6599590,6599700..6600485)
Genome map
AA seq 775 aa AA seqDB search
MPAPSPGNSTQPRRSALKADGEAERVSPLSAPVKAVQIAEPAPSPASPDDLQVKKQFSAG
VAAKRLSGRPPLPATPSRPSTLSQASSEGGQNSAVATSSTASGEEVQTQQPHAHHRHKPD
MVTERLLSQVAEWLEREKVKQASRRSRRSRLRGKTPHNDVSIPVPEPGRPRADSIESDSS
EASLDRLQRILDESMAALGLGSLTQPLPRLGRRHRKRSSRNLARAASSDTEWLDDDVVVP
SCDAFLDNSKTLAYSGGKASAEDGASVSSRKEEKERQHWITFKNEIIRLAHTLRLKGWRR
VPLDSGETISVERLSGALTNAVYVVSPPPESLLPREPGKKQPGKVLLRVYGPQVDHLIDR
ENELGVLRRLARKKIGPRLLGTFLNGRFEQYLNATALTPGSMREADTSRQIAKRMRELHD
GIELLEEEKDQGPAVWKNWDKWVGQVEKAVLFLDRRTLSHSQNPSNGASKSPGFVCGVQW
PVFKALVEKYRRYVDAYYGDPKKIRDRLVFAHNDTQYGNILRVRPDDQKSPLLQPANEHK
QLVVIDFEYAAANVPGLEFANHFTEWAYNYHDAVRPYACDTSRYPTPEQQRRFIRAYVDH
RPQYSRADSPAASAGAAAGSAPSPSASNGLHAVPSTSSIVDFMLDARAPAGGWKEEERKR
EEEAEAKVRALLEETRLWRTANSAQWVAWGIVQAKIPGLDAAGGAKMPGKEEEEAAAAGA
NGETESEDDAEDEFDYLAYAQERAFFFLGDCVLKGLVKPEELGDEVRGKLKFVEY
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaccctccccagggaattcaacccagccaaggcgctccgccctcaaggccgac
ggcgaggccgagcgggtgtcccctctcagcgctcccgtcaaagctgttcagatcgctgag
cccgcgccctcgcctgcttctcccgatgacctgcaggtgaagaagcaattctcggccggt
gtcgctgcgaagcgactcagcggacgaccccctcttcccgccaccccttcgcggccttct
accctcagccaagccagctcggaaggtggccagaactcggcagtcgcaacctcttctacc
gcctccggagaagaagtccagacccagcagcctcatgctcatcaccgacacaagcccgat
atggtgaccgaacggctcctgtcccaggtggcagagtggctcgagcgggagaaggtcaaa
caagccagcaggaggtcccggcggtcccgcctacggggaaagacaccgcacaacgatgtc
agcattccggttcccgaaccggggaggccccgcgccgattccatcgagtccgactcgagc
gaggcgtcactggaccgtctgcagaggatcttggacgagagcatggccgccctgggcttg
ggttccctcacgcaacctctgccgcgtttgggacggagacaccgaaagagatcgagcagg
aacctcgcccgggccgcgtcgtccgacaccgagtggctcgacgacgacgttgtggtgccc
agctgcgatgccttcctggacaattcaaagactcttgcctacagcggcggcaaagccagt
gccgaagacggggcctccgtctcgagccgtaaggaggagaaagagcgacagcactggatc
accttcaaaaacgagataatccgtctggcgcatactctgcgcctcaagggctggaggcgc
gtcccgctagacagcggcgaaaccatctcggtcgagcgccttagtggcgcgctgaccaat
gccgtctacgtggtgtcgccgcccccggagtccctactgccccgggaacccggcaagaag
cagccgggaaaggtgttgctgagggtctacgggccccaggtggatcacttgatcgaccgg
gagaacgagctgggagtgctcagacggcttgctcggaagaagatcggcccccggctgcta
ggcacgtttctcaacggcaggttcgagcagtacttgaatgccacggcgctgaccccgggc
agtatgcgtgaagcggacacgtccaggcagattgccaagcgtatgcgggagctgcatgac
ggcattgagctgctcgaggaagagaaggaccaagggccggcggtgtggaagaactgggac
aagtgggttggtcaagtcgaaaaggcggttttgttcctcgatagacggaccctctcccat
tcccagaacccatcaaacggcgcgtcgaaatcgccgggtttcgtttgtggtgtgcagtgg
cccgtcttcaaggcgctcgtagagaaatatcgccgatacgttgatgcctactacggcgat
cctaagaagatacgcgacaggcttgtctttgcccataatgatacacaatacggtaacatc
ctccgcgtccggcccgacgaccaaaaatcgccgctgctccagccggccaacgaacacaaa
cagctggttgtgatcgactttgagtacgccgcagccaacgtgccgggtctagagtttgcg
aaccactttaccgagtgggcctacaactaccacgacgccgtccggccctacgcctgcgac
acgtcgcggtacccgaccccggagcagcagcggcgcttcatcagagcctacgtggaccac
cgcccgcagtattcccgcgctgactccccagctgcttctgccggcgccgcggccggctcc
gctccctcgccgtctgccagcaacgggctgcacgccgtgccgtcgacgagctcgatcgtc
gacttcatgttggacgctcgcgcccccgcgggcgggtggaaggaggaggagcgcaagagg
gaagaggaggccgaggccaaggtgagggcgctcctagaggagacgaggctgtggcggacc
gccaacagcgcgcagtgggtcgcctgggggatcgtgcaggccaagatcccagggctggat
gcggctggcggggcgaaaatgccagggaaggaggaggaggaggcggcggcggcgggcgcc
aatggagagacggagagcgaggacgatgccgaggacgagttcgactacctcgcctacgcg
caggagagggccttcttcttcttgggagactgcgtcttgaagggactggtcaagcccgag
gagctcggagatgaggtccggggaaagctcaagtttgtcgagtattga

DBGET integrated database retrieval system