KEGG   Myceliophthora thermophila: MYCTH_2297709Help
Entry
MYCTH_2297709     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mtm04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6790109..6790307,6790390..6790485,6790551..6791091,6791172..6791499)
Genome map
AA seq 387 aa AA seqDB search
MAATVAHSQAIPSGLHPLQAAALRAAAGNGQQQPQPPPREIDDKPFDVTSRKLSVNDLVK
VRTLGTGTFARVCLVRPSHGTEADRSRVYALKILRKTEVIRLKQIDHVRHERQILADVRG
HPFITNFVTSFSDHDFLYILLDYVPGGELFTYLRKYRRFDEDMARFYAAEIVLILEHLHE
QQGGIAYRDMKPENLLLDADGHIKLVDFGFAKRLGNNESGHPEETYTLCGTPEYLAPEVI
HNKGHTTAVDWWALGILIYEFLTGYPPFWHQNPIEIYKQIVEKPVVFPQEPPISDAAKDI
IRQFCTVDRSRRLGNISGGAAKVKAHPFFAGVDWDAVYQKRHRGPIIPPIRYPGDAQCFD
IYPEEDATRDEYTDEMAKQYDEYFKDF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacggtcgcgcattctcaggcgataccgtccgggctccatcccctgcaagca
gctgccctgagggcggccgccggcaacgggcagcagcaaccgcaaccaccgccgagggaa
atcgacgacaagcccttcgatgtgacgtctaggaaattgtctgtgaacgatctggtcaag
gttcggacattagggacaggcacctttgcccgtgtttgcctcgtccggccgtcccacggc
accgaagccgatcgcagccgggtgtatgccctcaagatactccgcaagaccgaagtgatc
agactgaagcagatcgaccatgtgcgccacgagcgacagatcctggccgatgtacgaggg
catccgttcattaccaatttcgtgacttcgttttcggaccacgacttcctctacattctc
ctcgactacgtgcccggcggcgagctcttcacttacctgcgcaagtatcgccggttcgac
gaagacatggcccggttctacgccgccgagattgtgctgattctcgagcatctgcacgaa
caacaaggagggatagcataccgggacatgaagccagagaacctgctgctggatgccgac
ggccacatcaaactggttgactttggtttcgccaagcggctggggaataacgagtccggc
cacccggaagaaacctacactctgtgcggcacacccgagtatctcgcgccagaggtcatc
cacaacaagggccacaccaccgcggtggactggtgggcgctgggaatcttgatctacgag
ttcctgacggggtaccctccgttctggcatcagaacccaatcgagatctacaagcagatc
gtcgaaaaaccagttgttttcccccaggaaccgcccatcagcgacgcggcaaaggacatt
attcgccagttctgcaccgtcgaccgctcccgccgccttggcaatatctcgggcggcgcc
gcaaaagtcaaggctcatcctttctttgcgggggtcgactgggacgctgtctaccaaaag
cgccaccgggggcccatcatcccccccattaggtatccgggtgatgcccaatgtttcgac
atttacccggaggaggacgcgacccgagacgagtacaccgatgagatggcgaagcagtac
gacgagtatttcaaggacttttag

DBGET integrated database retrieval system