KEGG   Myceliophthora thermophila: MYCTH_2298071Help
Entry
MYCTH_2298071     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtm  Myceliophthora thermophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2298071
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCTH_2298071
   00630 Glyoxylate and dicarboxylate metabolism
    MYCTH_2298071
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYCTH_2298071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7494889..7495249,7495339..7495916,7495996..7496396,7496495..7496725,7496798..7496855)
Genome map
AA seq 542 aa AA seqDB search
MASNEAILQGVSVLGPIKESQRKILTPQALAFLALLQRSFNATRKNLLERRKIRQAELDK
GALPDFLPETKHIRDDPIWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWDNMVNGQVNLYDAVRRQIDFKQGNKEYKLRTDRPLPTLIVRPRGWHLEEKHVT
VDGEPMSGSLFDFGLYFFHNAHETVKRGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETILAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKKFRQNSNFILPDR
ASVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKDDPAANEKAMEGVRADKLREV
RAGHDGTWVAHPALAGIASEIFNKHMPTPNQLFVRREDVTIGANDLLNMNVPGKITEEGI
RKNLNIGLGYMEAWLRGVGCVPINYLMEDAATAEVSRSQLWQWVRHGVTTAEGKRVDKGY
ALKLLKEQAQELAAKAPKGNKYQLAAQYFATQVTGEDYADFLTSLLYNEITSQESPKPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgaggccatccttcagggcgtcagcgtcctcggccctatcaaggagtcg
cagcgcaagatcctgactccccaggcgcttgccttccttgcccttctgcagcgctccttc
aacgcgacccgcaagaaccttctcgagcgccgcaagatccgtcaggccgagctcgacaag
ggcgccctgccggacttcctccccgagaccaagcacatccgtgacgatccgatatggaaa
ggcgccccgcccgccccgggccttgtcgaccgccgcgtcgagattacggggcccacggac
cgcaagatggtggtcaatgcgctgaacgccgacgtctggacgtacatggccgactttgag
gactcgagcgccccgacatgggacaacatggtcaatggccaggtcaacctgtacgatgcc
gtccgccgccagatcgacttcaagcaagggaacaaggagtacaagctccggactgaccgg
ccactgcccacgctcatcgtgcggccgcgcggctggcacctcgaggagaagcacgtcacg
gtcgacggcgagcccatgagcggctcgctcttcgactttggcctctacttcttccacaac
gcccacgagacggtcaagcgcggcttcggcccttacttctatctgcccaagatggagtct
cacctggaggcgcgcctgtggaacgacgtcttcaacctcgctcaggactacatcggcatg
ccccggggaaccatccgcggtaccgtgctgatcgagactatcctggccgccttcgagatg
gacgagatcatctacgagctgcgcgaccacagctccggcctcaactgcggccgttgggac
tacatcttcagcgtcatcaagaagttccgccagaactccaactttatactgcctgatcgc
gcctccgtcaccatgaccgtgcctttcatggatgcctatgtcaagctgcttatccagacg
tgccacaagcgtggcgtgcacgccatgggcggcatggcggcgcagatccccatcaaggac
gacccagccgccaacgagaaggccatggagggcgtccgcgccgacaagctgcgcgaggtg
cgcgcgggacatgacggaacatgggtggcgcacccggcgctggcgggcatcgcgagcgaa
atcttcaacaagcacatgcccacgccgaaccagctctttgtgcgccgcgaggacgtcacc
atcggcgccaacgacctcctcaacatgaacgtgcccggcaagattaccgaggagggcatc
cgcaagaacctcaacatcggcctgggttacatggaggcctggctccgcggcgttggttgc
gtgcccatcaactacctcatggaggacgccgccaccgccgaggtttcgcgcagccagctc
tggcagtgggtgcgccacggcgtgacgacggctgagggcaagcgtgtcgacaagggttac
gcgctcaagctgctcaaggaacaggcccaagagctggccgccaaggcgcccaaggggaac
aagtaccagctggctgcgcagtacttcgcgacccaggtcacgggcgaggactatgccgac
ttcctgacttcgttgttgtacaacgagatcacgtcgcaggagagcccgaagccggcttcc
aagctctag

DBGET integrated database retrieval system