KEGG   Myceliophthora thermophila: MYCTH_2298071Help
Entry
MYCTH_2298071     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtm  Myceliophthora thermophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mtm01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mtm00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mtm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7494889..7495249,7495339..7495916,7495996..7496396,7496495..7496725,7496798..7496855)
Genome map
AA seq 542 aa AA seqDB search
MASNEAILQGVSVLGPIKESQRKILTPQALAFLALLQRSFNATRKNLLERRKIRQAELDK
GALPDFLPETKHIRDDPIWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWDNMVNGQVNLYDAVRRQIDFKQGNKEYKLRTDRPLPTLIVRPRGWHLEEKHVT
VDGEPMSGSLFDFGLYFFHNAHETVKRGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETILAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKKFRQNSNFILPDR
ASVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKDDPAANEKAMEGVRADKLREV
RAGHDGTWVAHPALAGIASEIFNKHMPTPNQLFVRREDVTIGANDLLNMNVPGKITEEGI
RKNLNIGLGYMEAWLRGVGCVPINYLMEDAATAEVSRSQLWQWVRHGVTTAEGKRVDKGY
ALKLLKEQAQELAAKAPKGNKYQLAAQYFATQVTGEDYADFLTSLLYNEITSQESPKPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgaggccatccttcagggcgtcagcgtcctcggccctatcaaggagtcg
cagcgcaagatcctgactccccaggcgcttgccttccttgcccttctgcagcgctccttc
aacgcgacccgcaagaaccttctcgagcgccgcaagatccgtcaggccgagctcgacaag
ggcgccctgccggacttcctccccgagaccaagcacatccgtgacgatccgatatggaaa
ggcgccccgcccgccccgggccttgtcgaccgccgcgtcgagattacggggcccacggac
cgcaagatggtggtcaatgcgctgaacgccgacgtctggacgtacatggccgactttgag
gactcgagcgccccgacatgggacaacatggtcaatggccaggtcaacctgtacgatgcc
gtccgccgccagatcgacttcaagcaagggaacaaggagtacaagctccggactgaccgg
ccactgcccacgctcatcgtgcggccgcgcggctggcacctcgaggagaagcacgtcacg
gtcgacggcgagcccatgagcggctcgctcttcgactttggcctctacttcttccacaac
gcccacgagacggtcaagcgcggcttcggcccttacttctatctgcccaagatggagtct
cacctggaggcgcgcctgtggaacgacgtcttcaacctcgctcaggactacatcggcatg
ccccggggaaccatccgcggtaccgtgctgatcgagactatcctggccgccttcgagatg
gacgagatcatctacgagctgcgcgaccacagctccggcctcaactgcggccgttgggac
tacatcttcagcgtcatcaagaagttccgccagaactccaactttatactgcctgatcgc
gcctccgtcaccatgaccgtgcctttcatggatgcctatgtcaagctgcttatccagacg
tgccacaagcgtggcgtgcacgccatgggcggcatggcggcgcagatccccatcaaggac
gacccagccgccaacgagaaggccatggagggcgtccgcgccgacaagctgcgcgaggtg
cgcgcgggacatgacggaacatgggtggcgcacccggcgctggcgggcatcgcgagcgaa
atcttcaacaagcacatgcccacgccgaaccagctctttgtgcgccgcgaggacgtcacc
atcggcgccaacgacctcctcaacatgaacgtgcccggcaagattaccgaggagggcatc
cgcaagaacctcaacatcggcctgggttacatggaggcctggctccgcggcgttggttgc
gtgcccatcaactacctcatggaggacgccgccaccgccgaggtttcgcgcagccagctc
tggcagtgggtgcgccacggcgtgacgacggctgagggcaagcgtgtcgacaagggttac
gcgctcaagctgctcaaggaacaggcccaagagctggccgccaaggcgcccaaggggaac
aagtaccagctggctgcgcagtacttcgcgacccaggtcacgggcgaggactatgccgac
ttcctgacttcgttgttgtacaacgagatcacgtcgcaggagagcccgaagccggcttcc
aagctctag

DBGET integrated database retrieval system