KEGG   Myceliophthora thermophila: MYCTH_2298281Help
Entry
MYCTH_2298281     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
mtm  Myceliophthora thermophila
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mtm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(7787474..7788619,7788673..7789055,7789108..7790407))
Genome map
AA seq 942 aa AA seqDB search
MAAIQAAPAVAELDSLLCGSSFTSNDSTETSSSNFASPSSTPPTTVSPDSMSLASEPDLP
KPESGIAPSIEAVIAVTDSHEPRAEQHASGQQTPVGEDAIVVAEPPRPTESSELAEPSPT
SRPRRARSSLPVYNLAKLAGTDIHGKRRSKGDAVVDKRRRTISEGTLANHDDSAPNGSTD
ALERPNQAGQDNADASRTRGSAPVLHKPKSARVSKKSSSSPVPARLTRRAARLSGAPVEN
LTLKLSALGKRGKKAIEKGFGRLSRELLRLKDTDEFAHIDTRPVRYTVWSNGKYVDIDPS
QETPAREPPRKKVKVDEKANNDEQKAAPSEKPEAGAPDPAKKPRQKKWLEKGLYAGQEAP
TDIFKGLTAQEKKKLASLPELMRRGKPNKTFPLPMYNGLRILIHGRDFKLPFDVCNPLPP
GQPKPAAYRTMTKNRFVGDAASYWKKTPHIEDFASKCVCKPEDGCGEDCQNRIMLYECDE
TNCGIGKEYCQNRAFQDLQERTKKGGRYRIGVEVFKTKDRGYGVRSNRCFEPNQIIMEYT
GEIITVAECERRMNEEYKDNECYYLMSFDQNMIIDATTGSIARFVNHSCSPNCRMIKWIV
AGQPRMALFAGDRPIMTGEELTYDYNFDPFSAKNVQKCLCGSPNCRGVLGPKPKEVKTPK
PAKEEKKSVKTTRTTKTTKTSKASAKEKATVRTTVKVSTKTATKRKVKDAFEFDGDEEEE
AAKTVKKRKIKTSTGVKRTVSSAGLKAAKGAAKKAAKGVTTIKRSVSTISVSSKKKTGPS
SSSKVVTTKAAKVTKKKTTTAVQRGVSKKIAGKKSTSTTTSTATSAKSTTTAKPKTVVPS
RSPSLTIVAAGVTTPAAQKKKNSKGSSTPVSATPATSSSASAKGELPKLTISGSGKTSAR
KWTPSRKALEAGVVLAGSPASARSPAKAAGSPKIKLVSSGAK
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggcggctatacaagccgccccagcggtggccgagcttgactcgctgctgtgcgggtca
agcttcacaagtaacgactcgacagagacctcatcgtcgaatttcgcttccccgagctcc
acaccaccgaccacagtgtccccggatagcatgtctctcgcctcggagccggacctccca
aaaccagagagcggcatcgcgcccagcatcgaggcagtgatcgcggtcaccgattcgcac
gagccccgagccgaacaacacgcgtctggccagcaaacaccggtcggcgaggacgctatt
gtcgtcgcagagccgccccgacctaccgaatcctccgaactcgccgaaccttcccccacg
agccgcccacgacgagctcggtctagccttccagtctacaacctcgcaaaactcgctggc
accgacatacatggcaagcggaggtccaaaggagacgcagtcgttgacaagagacgccgc
accatttctgaaggcacgctcgcgaatcatgacgattcggccccaaatggctcgacagac
gcgcttgaaagaccaaaccaagctggccaagataatgccgacgcgtctcggacgcgtggc
tcagcccccgttcttcacaagccgaagagcgcccgagtctccaaaaaatcctcttcaagt
cccgtcccggcgcgtttgacgcgccgcgccgcgcgtctttctggtgcgcccgtcgaaaac
cttaccctgaagctctcggccctcgggaagcgtggcaaaaaggcgatcgagaagggattc
ggccggctctcgcgcgagcttttgcgtttgaaggacacggacgagttcgcgcatatcgat
acgcgcccggtccggtacacggtctggagcaacggcaaatacgtcgacatagatccgtcc
caggagacccctgcccgagagccgccgcggaagaaggtcaaggtggacgagaaggcgaac
aatgacgagcaaaaggcggcgccgtcggagaagccagaagctggcgcaccagacccagcc
aagaagccgcggcagaagaaatggcttgagaaaggtctctacgccggccaggaagcgccg
accgatatcttcaagggcctgacggcacaggaaaagaagaagcttgcttcactccccgag
ctcatgcgcaggggcaagccaaacaaaaccttcccgctgcccatgtacaatggcctgcgc
atccttatccacgggcgtgatttcaagctgccgtttgatgtctgcaatcccctgcccccc
ggccagcccaaaccggccgcatatcgcaccatgacgaagaaccgcttcgttggggatgcg
gcatcgtactggaaaaagacgccgcatattgaggattttgcgtccaaatgcgtctgcaag
cccgaggacggctgtggcgaggactgtcaaaatcgcatcatgctctacgagtgcgacgag
acgaactgcggcattggcaaggagtattgtcagaaccgcgcattccaggatcttcaggag
cgcaccaagaagggcggccggtaccgcatcggcgtggaagtcttcaaaacgaaggaccgc
ggttacggagtgcgcagcaatcgctgcttcgagccgaaccagatcatcatggagtatacg
ggcgaaatcatcaccgtcgccgagtgcgagcgccgcatgaacgaggagtacaaagacaac
gagtgttactacctcatgtccttcgaccagaacatgatcattgacgcaaccaccggtagc
atcgcgcggttcgtcaatcactcgtgctctccaaactgccggatgatcaagtggatcgta
gccgggcagcctcgcatggccctattcgccggcgaccgccccatcatgacgggcgaggag
ctcacctacgactacaactttgatcccttctcagctaagaacgtgcagaagtgtctctgc
ggtagtcccaactgccggggcgtgctgggcccgaagccaaaggaggtcaagacgccaaaa
ccggccaaggaagaaaagaagtctgtcaaaacgaccaggacgactaagacgaccaagacg
tccaaagcttcggccaaggagaaggccacggtcaggacgaccgtcaaggtatccaccaaa
acagcaacgaagcggaaggtcaaggatgcctttgagtttgacggagacgaggaggaggaa
gccgcgaagacggtcaaaaagcgcaagatcaagacgtcgaccggcgtcaagcggaccgtg
tcctcggccggtctgaaggcggcaaagggagcagcgaagaaggcagccaagggcgtcacc
accatcaagcggagcgtgtcaactatctcggtctcctcaaagaagaaaacgggcccgagc
tcgtcttccaaggtagtcacgactaaggcggccaaggtaaccaagaagaagacaaccacc
gccgtccaacgcggcgtctccaaaaagatcgctggcaagaaatctacctccacgaccact
tccaccgcgaccagtgccaaaagcacgaccacggcaaaaccgaagacagtcgtcccctcc
cgcagcccaagcctaaccatcgtggcggcaggcgtcaccacccctgcagcgcaaaagaag
aagaactccaaggggagttcgactccggtctcggcgacgcccgcgacttcgtcctcggct
tcggctaagggagagctgcccaagctgacaatctcgggcagcggcaagacttcggcacgc
aagtggactccctcgcgcaaggcactcgaggcgggcgtggtgctcgcgggaagcccggct
tcagccaggtcgccagccaaggccgcgggcagccccaagatcaagttggtcagcagtggt
gcgaagtag

DBGET integrated database retrieval system