KEGG   Myceliophthora thermophila: MYCTH_2299100Help
Entry
MYCTH_2299100     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCTH_2299100
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYCTH_2299100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(9107075..9107361,9107420..9110286,9110348..9111711)
Genome map
AA seq 1505 aa AA seqDB search
MDTVNSTALAAATAVAGTVDRHPNPLSSAVAAASDVANAHGSSSWLGLFARLVLWILQFV
SMVLYYAIKLATISVPTLLYTLFSTSLTVTMNATTLMLIIAAMIAAISWVVRYRYLNMYS
RLPPEPQRKEPDVDLFPDSHEEGIKPGLSNYFDEFLSAIKIFGYLERPVFHELTRSMQTR
KLIAGETFNLEEEKGFCLVVDGLVEIFVKSSNYSRRYAHSPYAASEAPSSDDEHPAPGQQ
RYQLLTEVRNGAPMSSLFSIMSLFTEDVPLRQTDEDGSEPGTAQHSALFSNYPQSADFRR
PPVRSDSLPPTPHPEESASNSVENLPEHLDPSLPRVPPISLDGNGFPKSQRPVPKRISTT
SAHPDIIARATVDTTVAIIPASAFRRLIKIYPKATAHIVHVILSRFQRVTLATAYNYLGL
STEVLQIERQMLKYTTHQLPNHLRGDALDRLKEKFRRERERIGEVDVSKGIALHNPRAGR
RRRSTAGLRKEAALQAFSKQRTLSMAGSSSLVVPSAGDLATHLQQSRGGASRSQSVAFTD
GSASQFELRREATSPLAQRSFDPFATQRNVHIPLDKRDTMDEDNLFRESILECMFRAIGL
TGNSGLNKDTDSNQASPRLISLEQRRQKTHFTNHAFGFMDGLDGSFDGETESMTSASMPS
SPNPQILAQDMQDEMEIVFFPKGSVLVEQGERNPGLYYVVDGFLDICTREIASSSDAAHA
HGRSSIYAMDNAQPRYPSHRFADPMRSGDNVDGAEARPKTSRRSVGLIKPGGLAGYVGTI
SSYRSFIEVVAKTDVYVGFLPLASIERIVDKYPIVLLAMAKRLTNLLPRLILHIDFALEW
LQVNAGQVIYHERDESEAIYIVLNGRLRLVEDRKGGGMNVKAEFGQGESVGELEVLTESS
RSGTLHAIRDTELVKFPRTLFKSLAQEHPNITIKISRIIASRMRALIDDPSTMLGFKDPS
GRSSVNKSSTTLNLRTVAILPVSAGVPVAEFGNRLLNALTEVGTPNGATSLNSAAVLNHL
GKHAFNRMGKLKLSQYLADLEEKYGLVIYVADTNVNAPWTQTCIAQADCVLLVGLADGSP
EIGEYERFMLGMKSTARKILVLIHQERDSTPGLTRKWLKNRVWINGGHFHVQMTYSPNAV
PIHPPAKPGGPSLRERVQVLQAEIQKYTSRKLRHSPFYSPDAPFKGDFHRLARRLCGKSV
GLVLGGGGARGLAHIGIIRAMQEAGIPIDIVGGTSIGAFIGALYARHADFVPIVNAAKKF
SGRMASVWRFALDLTYPSASYTTGHEFNRGIFKAFGNTQIEDFWLDYYCNTTNISKSRAE
FHTSGYAWRYVRASMSLAGLLPPLCDEGSMLLDGGYVDNLTVSHMKSLGADVIFAVDVGA
LDDDTPQAFGDSLSGLWAFFNRWNPFSSVPNPPTLAEIQARLAYVSSVDALERAKTLPGC
IYMRPPVEEYGTLEFGKFNEIYAVGYEYGQEFLAKLRERGVLPLGEEMGGKKALRRTMAP
RRASI
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtgaactcgactgccctcgcggcggcgacggctgtggcgggaaccgtcgac
cgtcatcccaacccgctgtcgtcggccgttgctgcagctagcgatgtcgccaacgcccat
ggctcgtcttcgtggctcggcctcttcgcgaggctagttctctggattctgcagtttgtc
tcgatggtgctttactatgcaatcaagctggccaccatctcggtccctacactgctgtac
accctcttctcgacgagcttgacggtcaccatgaatgcgacaactctgatgctcatcatt
gcggccatgatagccgccatcagctgggttgtccgttaccgctacctcaacatgtactcg
cggctgccccccgaaccccagcgcaaggagccggacgtcgacctcttccccgacagccac
gaagagggcatcaagcccggcctgtccaactactttgacgaatttctcagcgccatcaag
atcttcggctatctcgagcggcctgtatttcatgagctgacccgcagtatgcagacccgg
aagcttatcgccggcgagacattcaacctagaggaggagaaaggcttctgcctcgtcgtc
gacggcctggtggagatttttgtcaagtcatcaaattacagccgccgctacgctcacagt
ccttacgccgcgagcgaggcgccttctagcgacgacgaacaccctgcccctggacagcaa
cgataccagttgctgaccgaggtccgaaatggcgctcccatgtcgtcgttattctcgatc
atgtctctctttaccgaagacgtcccgctgcggcaaacagatgaagacgggtcggagccc
ggcaccgctcagcatagtgccctcttttcaaactaccctcagagtgcagattttcgaaga
cctccggtcagatcggactcgctcccgcccactcctcatccggaggagtctgcatcgaac
tcggtagagaacctgcctgagcacctcgaccctagcctcccccgtgttccccccatctcc
cttgacggcaatggcttccccaaatctcagagaccggttcccaagaggattagcactact
tcggctcatcccgacattatcgcgagggcgacggtagacacgactgttgcgatcatccct
gctagcgcctttcgacgattgatcaagatctatcccaaggccacagcacatatcgttcac
gtcattttgtcacgctttcagagggttactcttgcaaccgcatacaactatctcggcttg
tccaccgaggtcctgcaaatagagcgccagatgctcaagtacacgacccaccaactcccc
aaccatctccgtggggatgctctcgacagactcaaggaaaagttcaggcgagagagggag
cggatcggcgaggtggatgtcagcaagggaatagctctgcacaatcctcgcgccggccgc
cggcgccgttcgacagccggtcttcggaaggaggcagcgttgcaggctttctccaagcag
cgtactctctccatggctggctcgtcgtctctggtggtccctagtgcgggagatcttgca
acgcacctgcagcagtcgagaggaggcgccagcagatcgcagagcgttgcttttaccgat
ggatcggcttctcagttcgagctgcggagagaagccacgtctcctctggctcagcggtcc
ttcgacccgtttgcgactcagcgaaatgtccatattccgctcgacaagagagacacgatg
gacgaggacaacttattccgcgagtcgatcctcgagtgtatgttcagggccatcggcctg
accggaaacagcggtctgaataaggacacggattcgaaccaggcctcgccacggctcata
tcgcttgaacagcgacgccagaaaacgcactttaccaaccacgcctttggcttcatggat
gggcttgatggatcgttcgacggcgagaccgagtcaatgacgtccgcatccatgccttct
tcgccaaacccacagattctggcgcaagacatgcaggacgagatggagatcgtcttcttc
cccaaggggtcggtgttggtggaacaaggagagaggaaccccggtctatactatgtcgtg
gacggcttcctggacatctgcacccgagagattgcttcatcctccgacgccgcccatgct
catggcaggtcatcgatctatgctatggacaacgcccagccacgctatccctcacaccgg
tttgcggaccctatgcgcagtggcgataatgtagacggcgccgaagctagacccaagacg
agtcgccgaagtgttggcttgatcaagcccggtggcctcgccggttacgtcggtaccatc
tcgtcgtacaggtccttcatcgaggtcgtggcgaagacggacgtctatgtcggcttcctc
ccgctcgcatccattgagaggattgtcgacaaatatcccattgtcctcctcgccatggcg
aagaggctgaccaatctgcttccccggctgattctgcacatcgacttcgccctggagtgg
ctgcaggtcaacgccggccaggtcatctaccacgagcgagacgagagcgaggccatctac
attgtgttgaacgggcgcctgagattggtcgaagatcggaagggcggcggtatgaatgtc
aaggccgaattcggccagggcgagagtgttggcgagctcgaggtgctcaccgagtcctcc
cgctccggcaccctgcacgccatacgggatacggagctcgtcaagttcccccgcacgctg
ttcaagagcctggctcaagagcacccgaatattaccatcaagatctcaaggatcatcgcg
tcccgtatgagggcgctgatcgacgatccgtcgacgatgctgggcttcaaggatccttcc
ggcaggagctcggtaaacaagagctcgaccacgctcaatctgaggactgttgccatcttg
cccgtctctgctggcgtgcccgtagcggagtttggcaataggctgctcaatgctttgacc
gaggtcggaactccaaacggcgccacgtcgttgaacagcgcggccgtcctgaaccatctc
gggaagcacgcattcaacagaatgggcaagctcaagctatcgcagtatctggcggacctg
gaggagaagtacggactcgtgatctacgtggccgacacgaatgtcaacgctccttggaca
caaacctgcatcgcacaagccgactgcgtcctcctagtcggcctggccgatggctccccc
gaaatcggagagtacgagcgcttcatgctcggcatgaagtccactgcgaggaagattctc
gtactcattcatcaggaacgcgactccaccccgggtctcacgaggaagtggctcaaaaac
cgggtttggatcaacggaggccatttccacgtgcagatgacctacagtcccaacgcggtg
ccgatccacccgccagccaagccggggggcccgagtctccgggaacgagttcaggttctg
caagccgagatccaaaagtacacgtccaggaaattgcggcacagccccttctactctccc
gacgcgccgttcaagggcgatttccaccggctggcccggcgtctgtgcggcaaatccgta
ggcttagtcctcggcgggggcggcgcgaggggcctcgcgcacattggcatcatccgggcg
atgcaggaggccggcatccccatcgacattgtgggtggcacctcgattggcgccttcatc
ggcgccctgtacgcgcggcacgccgactttgtgccgatcgtgaacgcggccaagaagttc
tcgggccgcatggccagcgtgtggcggttcgcgctcgacctgacgtacccgtcggcgtcg
tacacgacgggccacgagttcaaccggggcatcttcaaggcgtttggcaacacgcagatc
gaggacttctggctcgactactactgcaacacgaccaacatctccaagtcgcgggccgag
ttccacacgagcgggtacgcgtggcggtacgtgagggcgtccatgtcgctggccgggctg
ctgccgccgctgtgcgacgagggcagcatgctgctcgacggcggctacgtcgacaacctg
accgtgtcgcacatgaagtcgctcggggccgacgtcatcttcgccgtcgacgtcggcgcc
ctcgacgacgacaccccgcaggcctttggcgactcgctctcgggcctgtgggccttcttc
aaccggtggaaccccttctcgtcggtgccgaacccgcccacgctggccgagatccaggcg
cgcctggcctacgtcagcagcgtggacgcgctcgagcgggccaagacgctgccgggctgc
atctacatgcggccgccggtggaggagtacgggacgctcgagtttggcaagttcaacgag
atctacgccgtcggctacgagtacgggcaggagtttctggcgaagctgcgggagcgcggg
gtgctgcctctcggggaggagatgggcggcaagaaggcgctcaggaggacgatggcgccg
aggagggcaagcatatag

DBGET integrated database retrieval system