KEGG   Myceliophthora thermophila: MYCTH_2299427Help
Entry
MYCTH_2299427     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtm  Myceliophthora thermophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYCTH_2299427
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MYCTH_2299427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(9598110..9598920,9599040..9599114,9599246..9599327,9599465..9599540))
Genome map
AA seq 347 aa AA seqDB search
MASTTVPHITVLGSLNMDLVAYVPHHPLPGETLTADAFATSPGGKGANQAVACAKLSRSR
PESGPDVGETARVAMVGCVGADGHGAQLQSNLAGYGVDVSGVEARGGLTTGVAMIIVDKP
TGENRIVLSPGANHALRPEDLSTLARLRPRRDGEKKKEKGEEEGAQKLPDLLIMQLEIPF
DTVLAALAAARREGVDVLLNPAPARRLPDEAYAGLAHLVVNETEAAILGEVDERALDDEA
GLEKVAEGFVKKGVHNVIITLGGRGVYYYRSEDGRRGLVPAEKAKVVDTTAAGDTFVGQY
ALDAVVAKKGGEAFDIEAAVRKANKAAAKTVEKAGAQDSIPWRDELE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaccacagtcccgcacatcaccgtcctggggtctctcaacatggacctggtg
gcctacgtcccgcaccatccgctgccaggcgagacgctcacggcagacgccttcgcgacg
tcgcccggtggaaagggagcaaatcaggcggtggcatgcgcgaaactgtcacggtcgagg
ccggagtcggggcctgacgtaggcgagacggcgagggttgccatggtcggatgtgtcggt
gcggacggacacggcgcccagctgcagtccaacctggccggctacggcgtcgacgtgtcc
ggggttgaagcgcggggggggctcacgacgggtgttgccatgatcatcgtcgacaagccg
acgggcgagaacaggatcgtgctcagcccgggggccaaccacgcgctgcggccggaggac
ctgagcacgctggcccggctgcggccccgtcgggacggagagaagaagaaggagaagggc
gaggaggagggagctcagaagctgccggacctgctgattatgcagctggagatccccttc
gacacggtgctggccgcgctcgcggccgcccggcgcgaaggcgtggacgtgctcctgaac
ccggcgccggcgcgacggctacccgacgaggcatacgccgggttggcccacctggtagtg
aacgagaccgaggcggccatcctgggagaggtggacgagcgggcgctggatgacgaggcc
ggcctcgagaaggtcgcggaggggttcgtcaagaagggtgtgcacaacgtgatcatcacg
ctcggcgggaggggcgtgtactactaccggagcgaggacggcaggcggggcctggtgccg
gccgagaaggccaaggtggtcgacaccacggccgccggggacacgttcgtcgggcagtac
gcgctggacgcggtggtggccaagaagggaggggaagcgtttgacatcgaggccgccgtg
aggaaggcgaacaaggcggcggccaagacggtcgaaaaggctggggctcaggactcgatc
ccgtggcgggatgagctggaatag

DBGET integrated database retrieval system