KEGG   Myceliophthora thermophila: MYCTH_2299495Help
Entry
MYCTH_2299495     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mtm  Myceliophthora thermophila
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCTH_2299495
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MYCTH_2299495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(9706235..9706779,9706865..9707159))
Genome map
AA seq 279 aa AA seqDB search
MGTQIAITAAVVGVGAYAWYLRSSSTNRDKPVFSSFGFHTLRLESAELINHNTKKLRFDL
PDKSKPSGLSLTSALLTISFPNGRWLPVLRPYTPVNDLDEPGYIELMVKLYPGGKQSTHL
HSLRPGDTLTFAPIKELAWKPNKHPHVALIAGGAGITPMYQLARGILNNPADQTRITLVW
GVNTDEDIFLRDKFAAFERDHPGRFRAVYVVASPAAGSPHQKGFITKQILEGAGLSAREH
KNRDVKVLVCGPPAMEKALKKRTGVLAELGYRPDQVYSF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccaaatcgccatcaccgctgccgttgttggtgtcggcgcatacgcatggtat
ctgcggagcagcagcaccaatcgggacaagcccgttttcagcagcttcggcttccacacc
ctccgcctcgaaagcgccgagctgatcaaccacaacaccaagaagttgcgcttcgacctc
ccagacaagagcaagccgagcggcctctccctcacttccgccctgctgaccatctccttt
cccaacggccgctggctgccggtgctgaggccatataccccggtcaatgatctcgacgag
cccggctacatcgagctgatggtgaagctctaccccggcggcaagcagagcacgcacctg
cactcgctccgacctggcgacacgctcaccttcgcacccatcaaggagctggcctggaag
cccaacaagcacccgcacgtcgccctgattgccggcggcgccggcatcacccccatgtac
cagctcgcccgcggcatcctcaacaacccggccgaccagacgcgcatcaccctggtctgg
ggcgtcaacacggacgaggacatcttcttgcgggacaagtttgccgcgttcgagcgggac
cacccagggcggttcagagctgtttacgtggtggcgtcgcctgccgccggatcgccgcat
cagaagggtttcatcacgaagcagatcctggagggcgcggggctgagcgcgagggagcac
aagaatcgggatgtcaaggttctggtatgtgggccacccgcgatggagaaggcactgaag
aagcggacgggtgtgctagcggaactgggctatcgcccggatcaggtgtacagcttctag

DBGET integrated database retrieval system