KEGG   Myceliophthora thermophila: MYCTH_2299645Help
Entry
MYCTH_2299645     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mtm  Myceliophthora thermophila
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mtm00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(10103370..10103523,10103604..10103657,10103727..10104802,10104861..10105193)
Genome map
AA seq 538 aa AA seqDB search
MGQNSPAGPALPVQPQTPGTGIDTIHSGGDPVLVLSPGVTLTLGRDALLLSGQLSTKRSR
SCVPCIGNLGANGTPGSIPYYNILWAEITSDRRWLLIDYADETQSDCLEVRNAKFAIPEF
VAEQTPAEVGDQVAPWVDRLLDRAYGSSVRQKRAWVLVNPHAGPGGADKIWEKEVKPIFE
AARMPMTVVRTAYSGEAVDLARDLNIDDYDIAIPCSGDGLPHEVFNGLAKRPDARRALSK
IAVCHIPCGSGNAMSCNLYGTHRPRAAALAIVKGVPTPLDLVSITHGGKRTISFLSQALG
LIAEVDLGTEHLRWMGAARFTCGFLMLALQKKTYPCDIAVKVEIDDKEEIKRHYRDHITQ
RRNEPPKPAESQDAGAKPSGGFPTNTSPLHNDDDLGLPPLKYGTSLDKLPEGWELIPHEK
LGSFYCGNMAYMAPDANFFPAALSNDGLIDLITTNGDISFFKSVSMQLDVESGRFLDNPL
VSYRKVSAYRIIPRNQDSGHISIDGEAIPFGPFQAEVHQGLGLTLSKTGAFEAPGPLN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaaactcgcctgcgggcccggctctaccggtccaaccgcagaccccgggaacc
ggtatcgacacaatccatagtggaggagatccggttcttgttctctcgccaggggtcacg
ctcacgctcggccgggatgcgttgctcttgtccggccagctctccactaagcgcagtcgc
tcatgcgtgccgtgtatcggaaacttaggggccaatggcacaccaggcagcataccttac
tacaacatcctttgggctgaaattaccagcgaccgcaggtggctcctgatcgattatgct
gacgagacacaatcggactgcctcgaggtccgcaatgccaagttcgccatcccggagttt
gtggccgagcagacgcccgccgaagtgggcgaccaagtcgcgccctgggttgaccgcttg
ttggaccgcgcttacggcagttcagttcgccagaagcgagcctgggtactggtgaacccg
catgctggtcccggcggcgccgacaagatctgggagaaggaggtgaagcccattttcgag
gctgcgcgcatgccaatgacggtcgtacgcactgcctattccggcgaggccgtggacctg
gctcgcgacctaaacatcgatgactacgacattgccattccatgctcaggggatggtctg
ccacatgaagtgttcaacgggctcgccaagcgcccagatgcccgccgcgccctgtccaag
attgccgtttgtcatattccctgcgggtccggtaacgccatgagctgcaacttgtacggc
acccaccggccgagggcggcagcgctagccattgttaagggtgtaccgacgccgctggac
ttggtcagtatcactcatgggggcaagcgcaccatcagcttcctcagccaggcgctgggc
ttgattgcggaggtcgacctgggcaccgagcacctacgatggatgggcgccgcccggttc
acctgcggcttcctcatgttggccctgcagaagaagacatacccttgcgatattgctgtc
aaggttgaaattgacgacaaagaggaaatcaagagacactaccgagaccatatcacgcag
agaagaaatgagcctcccaagcccgccgagtcgcaagatgccggcgccaagccgagtggc
ggctttcctacgaacaccagtccgcttcataatgatgatgacttaggtcttccgcccctg
aaatacggcacctctttggacaagctgcctgaagggtgggaacttatcccccatgagaag
ttaggtagcttctactgtggtaatatggcctacatggcgccggacgccaatttcttccca
gcggcactttcaaatgacggccttatagacctaataaccacaaatggcgacatttcattt
ttcaaatcggtcagcatgcagctagacgttgaatctggtcgcttccttgacaacccgctc
gtgtcataccgcaaggtctcggcgtaccgcatcatcccgcgcaaccaggattccggccac
atcagtatcgacggcgaggctatccccttcgggccatttcaggccgaggttcaccaaggt
ctcggcctaaccctatccaagactggcgcattcgaagcgccgggtcctctcaattaa

DBGET integrated database retrieval system