KEGG   Myceliophthora thermophila: MYCTH_2299715Help
Entry
MYCTH_2299715     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mtm  Myceliophthora thermophila
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCTH_2299715
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCTH_2299715
   00640 Propanoate metabolism
    MYCTH_2299715
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MYCTH_2299715
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MYCTH_2299715
Enzymes [BR:mtm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MYCTH_2299715
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MYCTH_2299715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(10301627..10303197,10303249..10308095,10308152..10308417,10308498..10308680))
Genome map
AA seq 2288 aa AA seqDB search
MAETNGQGSGVNAPHTNGRATYAEQYNLPSHFIGGNTLENAPPSKVKDFVASHGGHTVIT
NVLIANNGIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYVEVP
GGTNNHNYANVELIVDVAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAM
RSLGDKISSTIVAQHADVPCIPWSGSGVNEVHIDEKGIVTVPDEVYRRGCVSSWQEGLEK
AREIGFPVMIKASEGGGGKGIRKVMDEEKFEELYKAAASEIPGSPIFIMKLADSARHLEV
QLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPATFKAMEEAAVRLGKLVGYVSA
GTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRIRDIRLL
YGVDPKTSTEIDFEFKNPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSNGVLHDLNFR
SSSNVWGYFSVGSAGGIHSYSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRTTVE
YLIKLLETDAFEQNTITTGWLDELISKKLTAERPDPMLAVVCGAVTKAHIASEACLAEYR
AGLEKGQVPAKDILKTVFPVDFIYEGSRYKFTVTRSSSDSYRLFINGSKCTVGVRALSDG
GLLILLSGHSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPSPGKLVKYTVENGAH
VRSGQTFAEVEVMKMYMPLVAQEDGIVQFIKQPGVTLEAGDILGILALDDPSRVKQAQPF
MGQLPDYGTPVVVGNKPSQRFSLQYSTLRNILLGYDNQIVMQDSLRELIAVLRDPQLPYS
EFAAQFSALHARMPNKLEAQFTQVLERATQRHAEFPARNLIKALQKFLDENIQSQADAEL
LRSTLAPLTAILESYADGQKVRELNVIADLLSQYADVERLFSGRRLQDEEVILKLRDQHK
DDIQKVVQTVLSHSRVAAKNSLVLAILEEYRPNKPNVGNVAKTLRPVLRKLAELESRQTA
KVSLKAREILIQCALPSLEERTAQMEHILRSSVVESRYGETGWDHRQPNLEIIKEVVDSK
YTVFDVLTLFFAHEDAWVSLAALETYVRRAYRAYVLKKIEYHTDDDKTPSFVSWDFALRK
IGQSEFGLPIQSAAPSTPATPIDQNFSRISSISDMSYLSQRAQEEPVRKGVIIACKYLDD
AEDQLSRALSTIPMAGGRKKSPNPLLELSDKRRPGPPARLDSTDELSAVVNVGIQDAEGR
SDDETLKDILPLIQQFKEELLARRVRRVTFICGRKDGSYPGYYTFRGPSYVEDDSIRHIE
PSLAFQLELARLSKFKIKPVFTENKNIHVYEGIGKDVETDRRFFTRAVIRPGRLRDEIPT
AEYLISEADRVINDIFDALEIIGTSNSDLNHMFLNFSPIFQLQPKEVEESLQGFLDRFGP
RGWRLRVAQVEIRIICTDPVTNTPYPLRVIITNTSGYVIQVEMYAERKSEKGEWVFHSIG
GTTKIGSMHLLPVSTPYPTKNWLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWTNAVKAN
PALAPNQPPTGECIDFNELVLDDQDNLAEVSREPGTNTCGMVGWLINARTPEYPAGRKFI
VVANDITYNIGSFGPKEDNFFFKCTELARKLGIPRIYLSANSGARLGLANELMPHFHVAW
NDPEKPEAGFKYLYLKDEAKHRFENEVITEEVTEDGEKRHKIVTIVGAEDGLGVECLRGS
GLIAGATSRAYNDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAPALNNLLGR
EVYTSNLQLGGTQIMYRNGVSHLTANDDFAGVSKIVEWMSFVPEKRNAPVPILPGVDHWD
RDVVYTPPQKQPYDVRWMIAGKQDEDGFQPGLFDKDSFVETLGGWARTVVVGRARLGGIP
MGVIGVETRSVDNITPADPANPDSIEQLTIEAGGVWYPNSAFKTAQAINDFNHGEQLPLM
ILANWRGFSGGQRDMYNEVLKYGSFIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPTIN
PTFMEMYADVEARGGVLEPEGIIGIKYRKDKQLETMARLDPLYSSLKKQMAKEGLSKEET
DNLKKQMTEREQQLLPVYAQISLQYADLHDRAGRMKAKGVIREVLEWRNARRFFYWRVRR
RLNEEYILRRIKNLTLGIHSKGGATYSSASTETARDRHLAMLQAWSGIPDFANNDREVAE
WYEKNRKLVHDKVDALRSEAIAAEMRDLVRAGSNNEATESAAWRGVRDMLRVMPVEERDR
ILDYLKQV
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaccaacggtcaagggagcggcgtcaacgctccccatactaacggcagggca
acgtacgccgaacagtataatctgccctcccacttcatcggtgggaatacacttgaaaat
gcccccccgtcgaaagtcaaagacttcgtagctagccacggtggtcacacggtcattacc
aatgtattgattgccaacaacggcatcgccgccgtcaaggagatccggtcggtacggaaa
tgggcatacgagacgtttggcgacgaacgggccatcaagttcacagtgatggccacccca
gaagatcttcaagcaaacgccgattatatccgcatggcagaccactatgtcgaggttcct
ggcggcacaaataaccacaactatgccaacgtcgagttaatcgtcgacgttgcggaacga
atggatgtccatgccgtttgggcaggatggggccacgcttccgagaacccaaaacttccc
gaatctcttgcagcatcacccaagaagattgttttcattgggccccctggctctgcaatg
cgatctcttggtgacaagatttcttcgaccattgtcgcacaacacgccgatgtgccatgc
attccctggtctggctcgggtgtcaatgaggttcacattgacgagaagggcattgtgaca
gttcccgacgaggtctaccgcaggggttgcgtgtcttcgtggcaagaaggtctggagaag
gccagagagatcggctttcccgttatgatcaaggcttcggaaggcggtggtggcaagggt
atccggaaagtgatggacgaagagaagtttgaagagctctacaaggcagcagccagtgaa
attcctggctcgcccatcttcatcatgaagttggcggacagtgccaggcacttggaagta
cagctgctcgcggatcaatacggcaacaacatttccctgttcggacgagactgttcggtg
cagcggagacaccagaagatcatcgaggaggcgcccgtcacgattgccaagcccgctacc
ttcaaagccatggaggaggccgccgtccgtctcggcaaactcgtcggctacgtttccgct
ggcactgtcgagtatctctactcgcatgccgatgacaagttctacttcttggaactcaac
ccccggttgcaagtcgagcatccaaccacggaaatggtcagcggcgtcaacctgccggct
gcccagctccagatcgccatgggactgcccttacaccgcatccgggacattagacttctg
tacggcgtggaccccaagacgtcgacggagatcgactttgagttcaagaacccggagagt
gaaaagacgcagaggcgtccaacacccaagggccacaccactgcttgccgtatcacttct
gaagacccgggcgagggcttcaagccgtcaaacggcgtgctccatgacttgaacttccgt
tcaagctccaacgtgtggggttatttctcggtcggctcggctggtggaatccacagctac
tcggactctcagtttgggcatattttcgcctatggcgagaaccgcgctgcctcgcggaag
cacatggttgtcgccttgaaggagctcagtatccgtggcgatttccggactacggttgag
tatctgatcaagctgctcgagacggacgcctttgagcaaaacaccatcacaaccggctgg
ctcgatgagctgatttccaagaagctcaccgccgagaggcccgaccccatgctcgcagtt
gtctgcggtgctgttacgaaagcacacatcgcaagcgaggcatgcctcgctgagtaccgc
gccggtctcgaaaaggggcaggtccccgccaaggatattctcaaaacagttttccccgtt
gatttcatctatgagggctcccggtataagttcaccgtcacacgctcgagctctgacagc
taccgtctcttcatcaacgggtccaagtgcaccgtcggcgtgcgtgccctcagtgatggc
ggcctcctcattctcctgagtggtcacagtcacaacgtctactggaaagaggaagcggct
gccacacgcttatccgtcgacggcaagacgtgcctgctcgagcaggagaacgacccaacc
cagctacggtccccgtcgcctggtaagctggtcaagtacacggtcgaaaacggcgcccat
gtccggtccggtcaaaccttcgctgaggtggaggttatgaagatgtacatgccccttgtt
gctcaagaggacggcatcgtgcagtttatcaagcagcccggcgtgactctcgaggccggt
gacattctcggcattcttgctcttgacgacccaagtcgggtcaagcaggcccagcctttc
atgggccagcttccggactacggcactccagtcgtggttggcaacaagccctcacagcga
ttctctctccagtacagcacgctcaggaatatcctgttgggctatgacaaccagatcgtc
atgcaggactctttgagagagttaatcgcagtccttcgcgacccgcagttgccgtacagc
gagtttgcggctcaattctcggcactccatgcccgcatgcccaacaaacttgaggcccag
ttcacacaagttttggagcgtgctacgcaaaggcacgccgagttccctgcgcggaatctc
atcaaggcactccaaaagttccttgacgagaacatccagtcacaggccgacgccgagctg
cttagatccaccctggcgccactcacagcaattcttgaaagttacgcggacggtcagaaa
gttcgcgaactcaacgtcattgcagatttgctgtcccagtacgcagatgtggagcgtctg
ttctctggtcgccggttgcaggatgaggaggtcatcttgaaacttcgggatcagcacaag
gacgacattcagaaggttgttcagaccgtcctctcccatagcagagtcgccgcgaaaaac
tcgttggttctggccattctcgaagagtatcgcccgaacaagcccaatgtcggcaatgtc
gcaaagactctccggcctgtcctgcggaagctggctgagcttgagtctcgtcaaacagcc
aaagtctcgctcaaggcacgcgagattctcattcagtgcgctctgccgtcgctcgaggaa
aggaccgcccaaatggagcatattcttcgctcctctgttgtggagtcccggtacggtgag
accggttgggatcaccgccaacctaatctggagatcatcaaagaagttgtcgactccaag
tataccgtgttcgacgtgcttacgcttttcttcgcccacgaggatgcctgggtgtctctg
gctgcactagagacatatgttcgtcgggcttatcgtgcgtatgttctcaagaaaatcgag
taccataccgacgacgacaagacgccttctttcgtctcctgggactttgctcttcgcaag
attggccagtcggaattcgggttgccgatacagtcggccgctccgtcaactcctgcgacg
ccgatcgaccagaacttctcccggatcagctccatcagcgacatgtcgtacctgtcgcag
agggcacaggaagaaccggttcggaagggcgtgatcatcgcttgcaagtatctcgacgac
gccgaagatcagctttcgagggctctcagcactattccgatggcgggtggacgcaagaag
agtccaaaccctctgctcgagctcagcgacaagcgtcgaccgggaccgcctgcacgcctc
gacagcacggatgagctctctgctgtggtcaatgttggaattcaggatgccgaaggccgc
agcgacgacgagaccttgaaggatattctgcctctgatccaacagttcaaggaagagctc
ttggcccgccgtgttcgccgcgtcaccttcatctgcggccggaaggacggttcctacccc
ggctattacaccttcaggggtcctagctacgtcgaagacgacagcattcgtcacatcgag
ccgtctctcgccttccagcttgaactcgcccgcctgtcaaagttcaagatcaagccggtg
ttcaccgagaacaagaacatccacgtctacgagggtatcggcaaggacgttgagactgac
cggcgattctttacccgtgccgtcattcgaccaggcagactgcgtgacgagatccccact
gctgagtacctgatctcggaggcggatcgtgttatcaacgacatcttcgacgcactcgag
atcattggcacgagtaactcggatctcaaccatatgttcctcaacttcagccccatcttc
caactgcaacccaaggaggtcgaggagtcgctgcagggcttcctggaccggtttggtccc
cgtggatggcgcctgcgcgtcgcgcaggttgagattcgcatcatctgcacggatccagtc
accaacaccccgtatcccctgcgtgtcatcatcaccaacacctcaggatacgtcatccaa
gtagagatgtacgcggagcgtaaatctgagaagggcgagtgggtgtttcactctattggc
ggtaccactaagattggctcgatgcacttgctcccggtctcgacgccctacccgaccaag
aactggttgcaacccaagcgttacaaggctcacctcatgggaacccaatacgtctacgat
ttcccggaactcttccgccaggcaattcagaacagctggacaaatgcggtcaaggcgaat
cctgcgttggcgccaaatcaaccccccactggtgaatgcatcgacttcaacgagctcgtc
ttggacgatcaggacaacttggccgaggtgtcccgcgagcctggtactaacacttgcggt
atggtcggctggttgatcaacgctcgtacgcccgaatatcccgcgggacgtaagttcatt
gttgtggccaacgacatcacctacaacattggctccttcggtcccaaggaggacaatttc
ttcttcaagtgcaccgagttggctcgcaagctgggcatcccccgaatttacctgtcggca
aactctggtgcccgccttggtctcgccaacgagttgatgcctcattttcacgtcgcttgg
aatgatcccgagaagcccgaagccgggttcaagtatctctacctcaaggatgaagccaag
cataggtttgagaatgaggtcatcacagaagaagtcacagaagacggtgagaagcggcac
aaaatcgtcactatcgtcggcgctgaggatgggttgggcgtcgaatgcttgcgcgggtcg
ggtttgattgcgggtgccacaagcagggcttataatgacatcttcacctgcacgctcgtg
acctgccgctctgtcggtatcggtgcgtacctcgtacgtctcggccaacgtgctgtgcag
atcgagggccaacccatcatactcactggtgctcccgcgctcaacaatctgctcggacgt
gaggtctacacttccaacctgcagcttggcggcacccaaatcatgtatcgaaacggtgtc
tctcatctgacagccaatgacgatttcgccggcgtctccaagatcgttgaatggatgtca
tttgtcccggagaagcgaaatgccccggtgccgatcctccctggcgtcgatcactgggac
cgagacgtcgtctacacgccgcctcagaagcagccttacgatgtaaggtggatgattgct
ggcaagcaggacgaggatggcttccaacctggcctgtttgacaaagattcattcgtcgaa
acgcttggcggctgggcccgcactgttgtggttggccgtgcccgtctcggtggtatccct
atgggcgtcatcggcgtcgagacccgatctgtcgacaacatcacccccgccgaccctgcc
aatcccgactcgattgagcagctcacgatcgaggccggtggtgtctggtaccccaactcc
gcgttcaagacggctcaagccatcaacgacttcaaccacggtgagcagctgccgctcatg
attcttgccaactggcgcggtttctcgggtggccagcgtgacatgtacaacgaggttctc
aagtatggctccttcattgttgatgccttggtcaagtttgagcaacccgtcttcatctac
attccgcccttcggtgagcttcgcggtggctcgtgggtcgtcgtagatccaaccatcaac
cccacctttatggagatgtatgcggacgtggaagcccgcggtggtgttctggagcccgag
ggtatcattggcatcaagtaccgaaaggataagcagctcgaaacgatggcccgccttgat
ccactctactccagtctcaagaagcagatggccaaggagggtctatccaaggaggagacg
gacaatctcaagaagcagatgacggagcgtgaacagcagctcctgcccgtctacgcccag
atcagcctgcaatatgccgacctgcacgaccgcgccggacgcatgaaggcgaagggtgtt
atccgggaagtgctggagtggcgcaatgcccgacgcttcttctactggcgcgtgcgcaga
agacttaatgaggaatatattctccggcgcatcaagaacctcaccttgggcatccacagc
aagggcggtgccacgtactcttcggcatcaaccgagacagcgcgcgatcgtcacctcgcc
atgctgcaggcgtggagcggaattcccgactttgcgaacaatgacagagaggtggcggag
tggtatgagaagaaccgaaaactggtacacgacaaggttgatgcgcttaggagcgaggcg
atcgcggccgagatgcgggatctcgtgcgcgccggcagcaacaacgaggctaccgagagc
gctgcttggaggggcgtgcgcgacatgctacgcgtgatgcccgtagaggagagggacagg
attctcgactatttgaagcaggtttaa

DBGET integrated database retrieval system