KEGG   Thermothelomyces thermophila: MYCTH_2300003Help
Entry
MYCTH_2300003     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00790  Folate biosynthesis
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_2300003
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYCTH_2300003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 11511713
NCBI-ProteinID: XP_003661051
JGI: 2300003
UniProt: G2QA58
Position
2:complement(106239..107231)
Genome map
AA seq 330 aa AA seqDB search
MAHSESSSGSESPAPVVNGDKSRRSKSKNNNNNNGKKRSREGDPKDAASDADANGAHPLG
ERRSSVSKPARDFRDKPEPPPKKKKRKTPAPAAPAPAVKETPTAEEAAEQSTRSPSPVID
FDGLSRPSVGTRKRVDEDDEQKQARLERMKGAVRTLLECVGEDPDREGLLATPDRYAKAM
LYFTKGYQENVRDIVNGAIFQEGHNEMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAV
IGISKLPRIAEMFARRLQVQERLTKEVANAVMEVLKPQGVAVVMESSHLCMVMRGVHKTT
STTITSCVLGCFERKEKTRNEFLSLIGVNR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctcactccgaatcctcgtctggctccgagagcccggcgcccgtggtcaatggcgac
aagagcaggcgaagcaagagcaagaacaacaacaacaacaacggcaagaagcggtcgcga
gagggagaccccaaggatgctgccagtgacgccgatgctaacggtgcgcatccgctcgga
gagcgccgctcgagcgtcagcaaacctgcgcgggacttccgggacaagccggagccgccg
cccaagaagaagaagagaaagacgccggcaccggccgcccccgcccccgccgtaaaggaa
acgccgacggccgaggaagccgccgaacaatcgacccggtctccgagccccgtcatcgat
ttcgacggcctgagccggcccagcgtcgggacgcggaagcgcgtagatgaggacgacgag
cagaaacaagcccggctggagcgcatgaagggtgccgtccggacgctcctcgagtgcgtc
ggcgaggaccccgaccgcgaaggcctgctcgccacgcccgaccgctacgccaaggccatg
ctgtactttaccaagggctaccaggaaaacgtgcgcgacattgtcaacggcgccatcttc
caggagggccacaacgagatggtcattgtcaaggacattgaggtcttcagcatgtgcgag
caccacctggttcccttcaccggcaagatgcacatcggctacataccctccaacgccgtc
atcggcatctccaagctgccgcgcattgccgagatgtttgcccgccgactccaggtccag
gagcgcctgaccaaggaggtggccaacgccgtcatggaggttctcaagccccagggcgtc
gccgtcgtcatggagtcgagccacctgtgcatggtcatgcgcggcgtccataagaccacc
agcaccaccatcaccagctgcgtcctgggctgctttgagcgaaaggaaaagaccaggaac
gagtttctgagcttgatcggcgtcaaccgctga

DBGET integrated database retrieval system