KEGG   Myceliophthora thermophila: MYCTH_2300221Help
Entry
MYCTH_2300221     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mtm  Myceliophthora thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(629217..630533,630597..633605))
Genome map
AA seq 1441 aa AA seqDB search
MLSASSSNNHSLFSFGSRNGLSADVTDSAASFDFLPSVSFDDLQSSLESAAEFKLTQFPS
PTGQGTILGSGSAADHSMVERPDITRNARGIHASVQQPAATRSRTGSILRKPSTSSRHAS
LTAAAPSNPGAQNAPSAPAATRSRRQSHYPPVSNASIARPPRKSTGDAGLGLDFEPRKRR
PSVASLSDRNGLEPPTRSSVDGGSRPTGDLLRAQAGSRSSKARSVQPPPRASQATLTPDT
SARSLDQPRMPTALPRSPRAAVKGASLACSKRVSVMPGAPQLPHVTGLGARTISPTDTRR
LKRLSMHHSQSQTPAPVLPNPPPLAANVRSSSRSPSMLPRKISTPSSSRTTPDPNRKSYS
SGLSVNSNGSFNNTTAVRTSTASVGHRNSQLLNSRLPAPKALASHVIAGRDDEEYVPPVP
AIPKAYESPKDPLAEAPSLEKRKSNLSHDASSVHSSNSTPSISGALNDGPSAKLQRRPSN
RKSIHTSKLDLESKPVAAHPKKSLQPLRLPPLTLGPLSTPTATKIAALQDKGSSERDLSP
PPTRQIVKTPTTPMTASKGSFFSRTRLEERHDIQHLRSSSSVHRLRRGTPPPPPEPASSS
DSFAAVKNGDQRSGPSPFLSSSVPKDGHMEVPFLKRSKTGGDLAAPLDAAADIPTPTHQS
KPSGPRAQKPVTTRQPKSPPPFSSPEEPQTSSSMSSLRRKLSLSWKRQNKNGSTNQPQGE
KAESKPAKHDSMPPPRIPASATANNIPSAKPASPAPSNKSNGTGTYLESRRRKSSASSLN
AIIAQEQRGRSDAAAKKESTLGTVSERNAAPQNPPVVQKGLKPRHSTAGLRHHDVWTAEL
DSYDLIAEEEMKKLGMRRKDTELAARTLDALRKRATPKERVSPQEAIRIAVLNIYERGEI
VDYKDVYFCGTQNAAKVVGDPQSDSPNFGYDDERGDYAIVPGDHLAYRYEIIDVLGKGSF
GQVVRCIDHKTGVLVAVKIIRNKKRFHQQALVEVNILQKLREWDPQNKHCMVNFTHSFYF
RGHLCISTELLDMNLYEFIKSNAFRGFSLKLIRRFTKQMLSSLNLLKQHKVIHCDLKPEN
ILLRHPLHTEIKVIDFGSSCFEHEKVYTYIQSRFYRSPEVILGMTYGMPIDMWSLGCILA
ELYTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRR
RPSSKTLQQVLKCDDEAFLDFIARCLRWDPDRRMKPEEAIRHEFITGQKTSVPVPRSAVR
DSSPSKRVNSIGIPRPLPEPPAAAKTATSGPLRSRDNAAAAAAASTAGGTLGANYGPGKP
STVPPSSGGGGGQTTTRRVSGMNASAGGVKRTSAGAAATAGSGGNNNNNTNNSGGVNGGA
NAASYSGVTSSVSNSSLPRASIRSVSGGLAGLGVGGGGAGGVGPRQDLAAAGATAAMSRH
A
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtgcttcctcctccaacaaccactcgctcttctctttcggcagcagaaatggc
ttgtccgccgacgtgaccgattccgccgcctcgttcgactttcttccctccgtcagcttc
gacgatctgcagagcagcctcgagtccgcggctgagtttaagctgacccagttcccgtcc
ccaaccggccaaggaaccatcctgggcagcggctccgccgccgaccacagcatggtggaa
cgtcccgatatcacgcgtaacgccaggggcatccacgcctccgtgcagcagccagccgcc
acgcgttcccggaccggctcgatcctgcggaagcctagcacgtccagtcggcacgcgagc
ctaacggcagccgctcccagcaatcccggggcgcagaatgcaccctcggccccggccgcc
acccgctcccgccgccagagccactatccccccgtttccaacgccagcatcgcgagaccc
ccgaggaagtcgaccggagatgccgggctaggcttggactttgagcctcgcaagcggaga
cccagcgtggcctctctatcggataggaatggcctcgagcctccgacgagatcttcggtc
gacggtggatcacgtcccacgggggaccttctccgcgcccaggccggttcgcgaagctcc
aaggcgagatcggttcagccgccgccgagagccagccaggccacgttgactccggacaca
agcgcccggtcgctggaccaaccccgcatgccgaccgcattacctcggtcgccgagggcc
gccgtcaagggggcaagcctggcctgttcgaagcgtgtctcggtgatgcctggggcgccg
cagctcccgcatgtcacgggcctgggcgcgagaaccatcagccctaccgacacaaggcgg
ttgaaacggctgtcaatgcaccacagtcaaagccaaaccccggctccagtcctcccgaac
ccgccgccattggcggctaatgtccgctccagctctcgctccccttctatgcttccccga
aagatctccacgcctagctcctcccggacgacaccggatccgaacaggaagtcatacagc
tccggtctttccgtcaactccaacggcagcttcaataacacgaccgcggtacgaacatcg
actgcctcggttgggcatcgtaattcgcaactcctcaattctcggctgcccgctccgaag
gcgctcgcctcccacgtgatagctggtcgtgacgacgaagaatacgtcccccccgtcccg
gcaatacccaaggcttacgaatcgccaaaggatccgctcgcggaagcgccatcattagaa
aagaggaagtcgaacctcagccatgacgccagtagcgttcatagcagcaattccaccccg
agcatctccggagccttgaacgacgggccctctgccaagctacagcgcagacctagcaac
cgcaagtcgattcacacttccaagttggatttggaatcaaagccggtggcagcacatccc
aagaagtcgttgcagccgttaaggctgcctccgctcacgttgggcccgctgagtacccca
accgcaaccaagatagccgcgctccaggacaagggctcatccgagagggacctatcgcca
ccccccacgagacagattgttaaaacaccaacgacgccgatgacggcctcgaaaggttcc
ttcttctcgaggacgcgacttgaggaacgacacgacattcagcatctcagaagtagcagc
tcggtacaccgactaaggcggggaacaccgcctcccccaccagagccagcaagctcatct
gactcgttcgccgccgtcaagaatggcgaccagagatccggcccatcacccttcctaagc
tcctcggtgcccaaagatggccacatggaagtaccgttcttgaaaaggtccaagacaggt
ggcgatctcgccgctcctcttgacgcagctgcggatattccgactccaacccatcagagc
aagccttcagggccccgggcgcaaaagccggtaacgacgaggcaaccgaagtcgccgccg
ccgttctctagccccgaagaaccccaaacttcttcgtccatgagctcgctcaggagaaaa
ctgagtctgtcttggaagcgtcaaaacaagaacggcagcaccaatcagcctcaaggggaa
aaggccgagtcgaaacccgccaagcacgattcgatgccgccgccccggatcccggcctct
gcgacggcgaacaacatccctagcgcgaaacctgctagccctgctccatcgaacaagtcc
aatggaactggaacgtatctggagtctaggagacggaagagttcggcctcgagtctgaac
gccatcatagcccaggaacagcgcggccgcagtgatgccgcagccaagaaggaatccacc
ctcggcaccgtttccgagcgcaacgcggctcctcaaaatccgcccgttgtgcaaaaggga
ttgaaaccgaggcactcgaccgccggcctgcggcaccacgatgtctggacagcggagctc
gacagctacgacctgatcgctgaggaggaaatgaagaagcttggcatgcgccgcaaggat
accgagttggctgcccggactctggatgcgctccggaagcgcgcgacccccaaagaacgc
gtcagcccccaggaagctatccggattgccgtcctcaacatctacgagcggggtgagatt
gtggactataaggacgtctacttctgtggcacacagaacgccgccaaggtggttggcgac
ccgcaatctgacagtcccaacttcggctatgacgacgagcgcggagactacgcgattgtt
ccgggcgatcaccttgcctaccggtacgagattatcgatgtgctcgggaaaggcagcttc
ggacaggtggtccggtgtatagaccacaagacgggtgttctcgtcgccgtcaagatcatt
cgcaacaagaagcggttccatcagcaggctcttgttgaagtgaacatcctgcaaaagctc
cgcgaatgggaccctcaaaacaagcactgcatggtgaacttcacccatagcttctacttc
cgcggccacctctgcatctctaccgagctgctagacatgaacctctacgagttcatcaag
tcgaacgccttcaggggcttctcactcaagttgatccgcaggttcacgaagcaaatgctg
agctcgctcaatctgctcaagcagcacaaggtcatccattgcgacctgaaaccagagaac
atcctcctacggcatccgctgcacaccgagatcaaagtcattgattttggctccagctgc
ttcgagcacgagaaggtgtatacgtatatccagtccaggttctatcgctcgcccgaggtc
atcctaggaatgacttacggcatgcccatcgacatgtggtcgctgggctgcatcctggca
gaactctacaccggcgtgcccatcttccctggcgagaacgagcaggagcagctggcctgc
atcatggaagtctttggcccaccggaaaagcacctgatcgagaagtcgacccgcaagaaa
ctcttcttcgacagcatgggcaagccgcgcttgactgtctcgtccaagggccgccgccgc
cgcccatcgtcgaagacgctccagcaagtcctcaagtgcgatgacgaagccttcctcgac
ttcatcgcccgctgcctccgctgggacccggaccgccgcatgaaaccagaggaagccatt
cggcacgaattcattaccggtcagaaaacgtccgtccctgtcccccgctccgccgtccgc
gactcctcccccagcaaacgcgtcaacagcataggcatcccccggcccctcccggaaccc
cctgctgccgcgaagacggcgacttctggaccgctccgctcccgcgacaatgcagcagca
gcagcagcagcctctactgctggtggcacattgggtgcaaactacggccccggaaagccc
agcaccgtcccgccctcctctggaggaggaggaggacagacgactacccgcagagtatcg
ggcatgaatgcctcggcgggcggcgtcaagcggacgagtgctggcgctgccgctaccgcc
ggcagcggtggcaataataataataatactaacaacagtgggggggttaatggtggtgcg
aatgctgcgagctacagtggtgtgacttcgtcggtgagtaatagcagcttaccgagggcg
tcgataaggagcgtgagtggcggactcgctggtctaggtgttggtggtggtggcgctgga
ggggttggaccgaggcaggatttggctgctgcgggtgcgacggccgcgatgagtcggcat
gcttag

DBGET integrated database retrieval system