KEGG   Thermothelomyces thermophila: MYCTH_2300401Help
Entry
MYCTH_2300401     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00860  Porphyrin and chlorophyll metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCTH_2300401
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MYCTH_2300401
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_2300401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 11511925
NCBI-ProteinID: XP_003661246
JGI: 2300401
UniProt: G2Q790
Position
2:complement(join(1054042..1054950,1055062..1055301))
Genome map
AA seq 382 aa AA seqDB search
MSFSSLVQDLSLRDSSAPRRRGEASVSTVDDRASHISMAKSYTSTAATSVSISGDIGSQL
HAGYSHPLARSWQAERQLTKSMLIYPIFVSDQDDEEVLIPSLPNQYRRGINRLVPFLEPL
VHKGLRSVILFGVPLKPGTKDALGTAADDPEGPVIRSIRLLRQRFPHLYIVADVCLCEYT
SHGHCGILRDDGSLNNQLSVDRISDVAVAYARAGAHCVAPSDMNDGRIRAIKLKLIEEGI
VHSVTLMSYAAKFSGCLYGPFRDAAGSTPSFGDRRCYQLPPGGRGLARRAIIRDINEGAD
IIMVKPAGQYLDIIADAKELGRDLPIAAYQVSGEFAMIHAAAKAGVFDLKSMAFESTESI
LRAGATIVISYFVPEFLDWLSN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcgagcctcgtgcaagatctatcgctgcgcgactcgagcgcaccgcggagg
cgcggcgaagcctcggtatctacggtcgacgaccgcgcgtcccacatctccatggccaag
tcgtacacgagcaccgctgccacaagtgtgagcatttccggagacattgggagccagctc
catgccggttactcgcatccgctcgcgaggtcatggcaggccgagcgtcaacttaccaag
tcgatgctcatctaccccatcttcgtctcggaccaggacgacgaggaggtcctcatccct
tccctgccgaaccaataccggcgcggaatcaaccgattggtccccttcctcgagcccctc
gtccacaagggcctgcggtccgtcatcctcttcggcgtgccgctgaagccgggcaccaag
gacgcgctgggcacggcggccgacgacccggagggccccgtgatccgcagcatccggctg
ctgcggcaacgcttcccgcacctctacatcgtcgccgacgtctgcctgtgcgagtacacg
tcgcacggccactgcggcatcctccgcgacgacggcagcctcaacaaccagctctcggtc
gaccgcatctcggacgtggccgtggcgtacgcgcgggccggcgcccactgcgtcgcgccc
tccgacatgaacgacggccgcatccgcgccatcaagctcaagctgatcgaggagggcatc
gtgcacagcgtgacgctcatgtcgtacgccgccaagttctccggctgcctctacgggccc
ttccgcgacgccgccggctcgacgccctccttcggcgaccgccgctgctaccagctgcct
cccggcggccgcggcctcgcccgccgcgccatcatccgcgacatcaacgagggcgccgac
atcatcatggtcaagcccgccggccagtacctcgacatcatcgccgacgccaaggagctc
ggccgggacctgcccatcgccgcctaccaggtcagcggcgagttcgccatgatccacgcc
gccgccaaggccggcgtcttcgacctcaagtccatggccttcgagagcaccgagagcatc
ctccgcgccggcgccaccatcgtcatcagctactttgtccccgagttcttggactggctg
tccaactaa

DBGET integrated database retrieval system