KEGG   Myceliophthora thermophila: MYCTH_2300779Help
Entry
MYCTH_2300779     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MYCTH_2300779
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MYCTH_2300779
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MYCTH_2300779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1623568..1626903
Genome map
AA seq 1111 aa AA seqDB search
MAPESFQTRRARPTRVKTDLATQTQLVAMPPSAISISSASPASQHGSPAQSVETIGTGMT
TGSSIQASPEVAEGCLDKEIDDLDQLVTPFQLPESISVKQQSEPATAYMSRRTSTASLSQ
PSFRSSGTTAMGEAVKMSIVRRASNTVRKAAGLMNRRPSSTHPRSRDGSVGPSVIRRRGS
MSNPTTPYENISTFDSDSENEVAFAAEDRAGDDATLPETGSILSSTSSDGFGLIPLSLRQ
GMTLTKVSKKKSTKRITLYLDPDTAKIWWDRNKYIYIDDIKEIRTAEDIRQYRLDAALPE
SVESRFFSLIYTLPGKSNTKLLHLIADSDESFQQWVEALETISKHRQDFATSLMSFNDKA
VRAYWGMEMERQLGKVRSAEDEHIDFAGVERVCRSLHIHVSTEELRRKFDMAKGRRNSSD
DLPSSAKHSSRLNFDEFLEFVRLMKTRSDIRAVYQAHASEPAGGMTRDEFFQFLREVQRE
DVDEDLAHWESVFARFARKGRPRDAEKQGILGEEGLTMSETAFAGFLTSTSNEPIPKEPQ
DYVLDRPMNEYYISSSHNTYLIGRQVASISSHEGYISALMRGCRCVEVDCWDGEGNQPVV
THGHTLTTSISFLEVIKTINKYAFVKSRFPLWISLEVRCNPITQINMAKIMIDVFGDKLV
RAPLDPTSDRLPSPSELMERILIKVKKPDESMRGADRPTGRRRGNSMPSPYQRALALDSM
PVPTPSSPLLSPSPTSMSNRQINTIAEGLVHEPVSSSPSECDSEGEAGAAKKANSKIHPI
LGELGVYCMGIHFDGFDSPDAKKFNHIFSFKEKTFAEKNQPGEAKRALYRHNMRYLMRVY
PNGGRISSSNFDPLIYWKRGVQMAALNWQTFDTGMQLNQAMFDGGTAHSGYVLKPLEGRQ
IQVMPNLAPDECVGKRPRKKVAFEIEVISAQQLMRPHNLGEKRTLDPYIEVEVLMADDKR
NKADAAAYAAAQQTQLKQRTNIVRDNGFNPEFNQTCTFDVTTKYPDLIFVRFSVKLADRG
GYNDKAPFATYTVKLSNLKQGYRTIPLYNHKGERFLFSTLFCRIKKGPVTDIMVSYQEDA
PRNGGNKLKNIGRNVFANTSPKSSMDSSRTT
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgagtcttttcagacgcggcgggcgcgtcccacccgggtcaagaccgacctg
gcaacccagacccagctggttgccatgccaccttcagccatcagcatatcctccgcatcg
cccgcctcgcaacacggctcgcccgcccagtcggtcgagactatcgggacgggcatgact
actggcagctctatacaagcttctcccgaggtagcagaggggtgcctcgacaaggagatt
gacgatctcgatcagctggtcacgcctttccaactccccgagtccatcagcgtcaagcag
cagtccgagccagccactgcttacatgtccaggaggacaagcactgcctcgctcagccaa
cccagcttcaggagttccggcacgacggctatgggcgaagccgtgaagatgagcattgtc
cggcgagcctcgaatacggttcgcaaggctgctggcttgatgaacaggcggccatcgtca
actcacccgaggagccgggatgggagtgtcggacccagcgtgattcgccggagaggaagc
atgagcaatccgacgacgccctacgagaacattagcacctttgatagcgactcggagaac
gaggttgcgtttgcagccgaagatcgcgcgggggatgacgcgaccctcccggaaacgggt
tccatcctctcgtcgacttcgtccgatggcttcggcctgatcccgctgtccctccgtcaa
ggcatgaccctgaccaaggtctccaagaagaagagcacgaagaggatcaccttgtatctc
gatcccgataccgctaagatctggtgggacaggaacaaatacatctacattgacgacatc
aaagagatccgcacggccgaagacatccgccagtatcgcctcgatgcagcgctcccggaa
agcgtagaatcccgattcttctcgctcatctacacgcttcccggaaaatctaacacgaag
ctcctgcacctcatcgccgatagcgacgaatcgttccagcagtgggtcgaggctctcgag
accatctctaagcatcggcaagactttgccacgagcttgatgtcgttcaacgacaaggcc
gtccgcgcgtactgggggatggagatggagagacagctgggaaaggtgcggtcggccgag
gacgagcatatcgattttgccggagttgagcgcgtgtgccgcagcctgcacatccacgtc
tcaactgaggagctccgcagaaagtttgacatggccaaaggcaggcggaacagctctgat
gatctgccgtcgagcgccaagcacagctcccgactcaactttgacgagttcctcgagttt
gtacgcctcatgaagacgcgcagtgacatccgagccgtctaccaggcccacgcgagcgag
cccgccggcgggatgacgagggacgagttcttccaatttctgcgcgaggtgcagcgcgag
gatgttgacgaggacttggcccattgggagtccgtctttgcgcggttcgcccgcaagggc
aggccgagggacgccgaaaagcaggggatcttgggcgaggaaggcctgaccatgtccgaa
accgcatttgctggcttccttacgtccacctcaaacgagccaattcccaaagaacctcag
gactacgtgctagaccggcccatgaacgagtattacatttcgagctcgcacaacacgtac
ctgataggccgccaggtcgccagcatctccagccacgagggctacatctcggctctgatg
cggggctgccgctgtgtcgaggtcgactgctgggacggcgaggggaaccagcccgtcgtg
acgcacggccacacgctgacgacgagcatctcgttcctcgaagtcatcaagactatcaac
aagtacgcattcgtgaaatcgcgctttcccttgtggatttcgctcgaggtgcgctgcaat
cccatcactcagatcaacatggccaagatcatgatcgacgtcttcggcgacaagcttgtg
cgcgcgcccctagacccgacttcggaccgcctgccgtcaccgtcggagctgatggagcgg
attctgatcaaggtgaagaagccggacgagtccatgaggggcgccgaccgacccaccggg
cgccgccgtggcaacagcatgccgtcgccgtatcagcgagcgcttgcgctggacagcatg
cccgttccgactccctcgagtcccctcctcagcccgtctccaacctcgatgtccaacagg
cagattaacaccattgccgagggcctggtccacgagccggtcagcagtagccctagcgag
tgcgacagcgaaggtgaagcgggagcggccaagaaggccaacagcaaaattcatcccatc
ctcggggagctgggcgtgtactgcatggggatccattttgacggtttcgacagccccgac
gccaaaaagttcaaccacatcttctcgttcaaggagaagacgtttgctgagaagaaccag
ccgggcgaggcgaagagggcgttgtaccgccacaacatgcgctacctgatgcgggtctac
cccaatggtggccgtatttcgtcgagcaactttgatcccctcatctattggaagcgcgga
gtccagatggccgccctcaactggcagacctttgacacgggcatgcagctgaaccaggcc
atgttcgacggcggcacggctcattcgggctacgtcctcaagccacttgaggggcggcag
atccaggtgatgccaaacctggctcccgacgagtgcgtgggcaagcgcccgcggaagaag
gttgccttcgagatcgaggtcatctccgcgcagcagctgatgcggccccataacctgggc
gagaagcgcacgctagatccctatatcgaagtcgaggtgctaatggcggacgacaagcgg
aacaaggcggatgcggctgcctatgccgcggctcaacagacgcagctcaagcagcgcacc
aatatcgtacgcgacaatggctttaaccccgagttcaaccagacgtgtactttcgacgtc
accaccaagtacccggacctgatcttcgtgcgattcagcgtcaagcttgctgacaggggc
ggatacaatgacaaggcgcccttcgccacctacaccgttaagctcagcaacctcaagcag
ggctaccgcacgatcccgctgtacaaccacaagggagagcgctttttgttttcgacgctc
ttctgcaggatcaagaaaggcccggtcacggatattatggtgtcgtaccaggaagatgca
cccaggaatggcggcaacaaactgaaaaacatcggcaggaacgtcttcgccaacacgagc
cctaaatcgagcatggacagcagccggaccacatga

DBGET integrated database retrieval system