KEGG   Myceliophthora thermophila: MYCTH_2300901Help
Entry
MYCTH_2300901     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCTH_2300901
Enzymes [BR:mtm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCTH_2300901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(1765391..1765904,1765958..1766553)
Genome map
AA seq 369 aa AA seqDB search
MVLLKSFVLAGLTAVAAAKSAVLDLIPDNFDKVVLKSGKPTLVEFFAPWCGHCKNLAPVY
EELALAFEHAKDKVQIAKVDADAERDLGKRFGVQGFPTLKFFDGKSDKPTEYNGGRDLES
LSSFITEKTGIRPRKKAAKPSNVVMLTDSTFKNQIGGDKNVLVAFTAPWCGHCKRLAPTW
ESLADTFASESNVVIAKVDADAETGKRTAAEYGVSGYPTIKFFPAGSTTPEDYNGARSEE
SFVTFLNEKTGTHRVAGGGLDATAGTVEALDTIVAKLVGGTALAEAAAEAKKVAESLTDE
VQAKYAKYYLRVFEKLSKSEEYAAKELARLEGIIKKGGLVPTKLDELTIKTNVLRKFVEK
ATDGEKEEL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcctcaagagcttcgtgctcgccggccttacggctgtcgctgccgccaagtcg
gccgtcctcgacctcatccccgacaacttcgacaaggtagtcctcaagtccggcaagcca
acactcgtcgagttctttgccccgtggtgcggccactgcaagaaccttgctcctgtctac
gaagagctcgccctcgcattcgagcatgccaaagacaaggtccagatcgccaaggtcgac
gccgatgccgagcgggatctcggcaagcggttcggcgtgcagggcttccccacgctgaag
ttcttcgacggcaagagcgacaagccgaccgagtacaatggcgggcgggacctggagtcg
ctgtccagcttcatcacggagaagacgggcatccggccgaggaagaaggcggccaaaccc
agcaacgtggtaatgcttacggattccaccttcaagaaccagattggcggtgacaagaac
gttttggtggcgttcactgctccatggtgcggacactgcaagaggcttgcacctacctgg
gagtcgcttgccgatacctttgccagcgagtccaatgtagtgattgccaaagtcgacgcc
gacgccgagacgggtaagcgcaccgccgccgagtatggcgtgagcgggtacccgaccatc
aagttcttccctgcgggcagcaccacgcccgaggactacaacggcgcacgctccgaggaa
tctttcgtcacattcttgaatgagaagaccggcactcaccgcgtcgctggtggtggtctt
gatgccaccgctggcacggttgaggcgcttgacaccattgttgctaagctggtcggcggc
accgcgctggctgaggcggctgccgaggcgaagaaggttgctgaatccctcacagacgag
gtgcaggccaagtatgccaagtactacttgcgtgtgtttgagaagctgagcaagagcgag
gagtatgcggccaaggagctcgcgcgcctggagggcatcatcaagaaaggcgggctggtg
ccgaccaagctggacgagctgacgattaagacgaatgtcctccgcaagttcgtcgagaag
gcgaccgatggcgagaaggaggagctgtaa

DBGET integrated database retrieval system