KEGG   Myceliophthora thermophila: MYCTH_2301102Help
Entry
MYCTH_2301102     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mtm  Myceliophthora thermophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MYCTH_2301102
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCTH_2301102
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MYCTH_2301102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2160035..2160495,2160600..2160642))
Genome map
AA seq 167 aa AA seqDB search
MASATTFYDFKVADKKGAEVSLADYKGKVVLIVNTASKCGFTPQYAGLEKLWKTVREKYP
DDFVILGFPCNQFGGQEPGTNEEIQEFCQLNYGVTFPIMAKIDVNGDNASPLFEWLKNEK
PGLLGLKRVKWNFEKFLVGKDGRVKGRWASTTKPESLEATILEELAK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcaacaaccttttatgacttcaaggtcgcagacaagaagggcgccgaggtg
tcccttgccgactacaagggcaaggtcgtcctcatcgtcaacacagcctccaagtgcggt
tttaccccgcagtacgccggcttggagaagctgtggaagacggtgcgcgagaagtacccg
gacgacttcgtcatcctgggcttcccgtgcaaccaattcggcgggcaggaacccggcacc
aacgaggagatccaggagttctgccagctcaattacggcgtcaccttccccatcatggcc
aagattgacgtcaacggtgacaacgccagccccctgttcgagtggctcaagaatgagaag
cccggcttgctggggctgaagagggtcaagtggaactttgagaagttccttgttggcaaa
gatggcagagtgaagggccggtgggcgtcgaccacgaagccggagtcgttggaggcgacc
attctggaggagttggcgaagtaa

DBGET integrated database retrieval system