KEGG   Thermothelomyces thermophila: MYCTH_2301102Help
Entry
MYCTH_2301102     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00480  Glutathione metabolism
mtm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MYCTH_2301102
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCTH_2301102
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MYCTH_2301102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-GeneID: 11510377
NCBI-ProteinID: XP_003661572
JGI: 2301102
UniProt: G2Q935
Position
2:complement(join(2160035..2160495,2160600..2160642))
Genome map
AA seq 167 aa AA seqDB search
MASATTFYDFKVADKKGAEVSLADYKGKVVLIVNTASKCGFTPQYAGLEKLWKTVREKYP
DDFVILGFPCNQFGGQEPGTNEEIQEFCQLNYGVTFPIMAKIDVNGDNASPLFEWLKNEK
PGLLGLKRVKWNFEKFLVGKDGRVKGRWASTTKPESLEATILEELAK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcaacaaccttttatgacttcaaggtcgcagacaagaagggcgccgaggtg
tcccttgccgactacaagggcaaggtcgtcctcatcgtcaacacagcctccaagtgcggt
tttaccccgcagtacgccggcttggagaagctgtggaagacggtgcgcgagaagtacccg
gacgacttcgtcatcctgggcttcccgtgcaaccaattcggcgggcaggaacccggcacc
aacgaggagatccaggagttctgccagctcaattacggcgtcaccttccccatcatggcc
aagattgacgtcaacggtgacaacgccagccccctgttcgagtggctcaagaatgagaag
cccggcttgctggggctgaagagggtcaagtggaactttgagaagttccttgttggcaaa
gatggcagagtgaagggccggtgggcgtcgaccacgaagccggagtcgttggaggcgacc
attctggaggagttggcgaagtaa

DBGET integrated database retrieval system