KEGG   Myceliophthora thermophila: MYCTH_2301334Help
Entry
MYCTH_2301334     CDS       T02231                                 

Definition
glycosyltransferase family 3 protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCTH_2301334
Enzymes [BR:mtm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MYCTH_2301334
Glycosyltransferases [BR:mtm01003]
 Polysaccharide
  Storage polysaccharide
   MYCTH_2301334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2509990..2510092,2510155..2511710,2511780..2512034))
Genome map
AA seq 637 aa AA seqDB search
MEPTIPELAETIQSMRDRGIGILYGRWLIEGAPRVLLFDTKTAYGYMNEWKADLWNVASI
PSPDNDEETNEAVVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLTRRRQIDVTT
IFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAHSCDVFTTVSH
ITAYESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQSKEKIHDFVRGHFYGHYDFDP
ENTLYFFTAGRYEFRNKGVDMFIEALARLNHRLKASGSKMTVVAFIIMPAQTSSLTVEAL
KGQAVIKSLRDTVDTIERNIGRRIFERSLKWHDGDPMPDEKELISSQDRVLLRRRLFAMK
RHSLPPIVTHNMVNDHDDPILNQIRRVQLFNHPSDRVKIVFHPEFLNSANPVLPLDYEDF
VRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGIYIVDRR
TKGVDDSVNQLTSYMFDFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLALRRA
YPMSFNGEEEEDYIPGVDQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGLSTEDYVA
WKLPEEEDPDEYPFPLTLRTKTAAVTSPPGGLPVNGN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccatccccgagctcgccgagacgatccaatcaatgcgagaccgcggtatc
ggtattctgtatggtcgctggctgattgagggcgcaccccgggtgctgctgttcgacacg
aagacggcttacggctacatgaacgagtggaaggctgatctctggaatgtggcgtccatc
ccctccccggataacgatgaggagaccaacgaggccgtggtcttcggctatcttgttgcg
tggtttctcggcgagttcgtgtgccacgagaagaagaaggctgttatcgcgcacttccac
gagtggttggcaggtgtcgcactgcctctgacgaggaggcgacagatcgacgtgacgacc
atcttcactacacatgctacgctgctgggccgttacctgtgtgccggctccgtagacttt
tacaacaacctgcagtactttgacgtcgacgcggaggccggtaagcgcggcatctatcac
cggtactgcattgagcgggctgccgcgcattcatgcgacgtcttcaccacggtctcccac
atcacggcctacgagagcgagcacctgctcaagcgcaagcccgacggagtgctgccgaac
gggctcaacgtaaccaagttctcggccgtccatgagttccagaacctgcatcagcagtcc
aaggagaagatccacgactttgtgcggggccatttctacggccactacgacttcgacccg
gagaataccctctacttcttcacggcagggcggtacgagttcaggaacaagggtgtcgac
atgttcatcgaggcgcttgcccgcttgaaccaccggctcaaggcgtccggcagcaagatg
acggtcgtcgccttcatcatcatgcccgcccagacctcgtcgttgacggtcgaggcgctc
aagggccaggccgtgatcaagagcctccgggacacggtggacacgatcgagagaaacatt
ggccggcgcatctttgagcgctcactcaagtggcacgacggcgacccgatgccggacgag
aaggagctcatctcgagccaggatcgcgttctgctccgccggcgcctgtttgccatgaag
agacacagcctgccgcccattgtcacgcacaacatggtcaacgaccacgacgacccgatc
ctgaaccagatccgccgggtgcagctcttcaaccaccccagcgaccgggtcaagatcgtg
ttccaccccgagttcctgaactcggccaacccggtgctgccgctcgactacgaggacttt
gtccggggcacccacctgggcgtgttcgcgtcttactacgagccctggggctacacgccg
gccgagtgcaccgtgatgggggtgccgagcatcacgacgaacctctcgggcttcggctgc
tacatggaggagctcattgagaattcgagcgactatggaatatacattgtggatcgccgc
accaagggagtggacgactcggtcaaccagctcacgtcgtacatgttcgacttcacccag
aagagccgacggcagcgcatcaaccagcggaaccggacggagcggctcagcgacctgctc
gactggaagcgaatgggcatggagtacgtcaaggcccgtcagctcgcgctgaggcgggcg
taccccatgtcgttcaacggggaggaggaggaggactacatcccgggtgtcgaccagaag
atctctcggcccttctcggtgcccggctctcctcgagatcgtaccggaatgatgaccccg
ggcgactttgccagcctccaagagggccgcgagggtctgagcaccgaggactacgttgca
tggaaactccctgaggaggaggatcctgatgagtacccgttccctctcaccttgaggacc
aagacggccgcggtaacaagcccgcccggcggtcttccagtcaacggcaactga

DBGET integrated database retrieval system