KEGG   Myceliophthora thermophila: MYCTH_2301751Help
Entry
MYCTH_2301751     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
mtm  Myceliophthora thermophila
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MYCTH_2301751
  Replication and repair
   03420 Nucleotide excision repair
    MYCTH_2301751
Transcription machinery [BR:mtm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MYCTH_2301751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(3482006..3482293,3482435..3482821,3482895..3483048,3483122..3483573))
Genome map
AA seq 426 aa AA seqDB search
MATEDERYRQSSQYQLWSFSPAQLAEMREKTNAAARARIAERLSSLPAHSNSTSTPASSV
NTPDPDGTPAPALPEFLTAAEEAQLVTFFTSELLRAGDHAEMSDEIKATAAAFFRRFYVT
NSIMTYPPQEMLIVALFFGCKAEGSFVSISDFVKTFGKDNPEEVLAGEFLLCQGLRFAID
VKHPFRALRGALMELAALPDIDRARLGAAETRAREILRFSPLITDAYFHYTPSQIMLAAL
SLADRGLAERLITKTFHHVSPPPDSGADTPSASGTDSGGAAAPSKTPAVRPGEDKAQIIG
SHLRDKVLGTIEACREMLAKELPERREHWTNKAVIKAQITPLRKKLNKCRDPERWNLIEL
QRTRRQQASKKADSEDDDPDDRKDGGNTLQSDAAVFGEPLAASRDNKRRKVQGNGTGLDD
PFGGPL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaagatgagcggtaccgtcagtcgtcgcagtaccagctgtggtctttctcg
cccgcccagctggccgagatgcgagagaagaccaacgcggcggctcgcgcgcgaatcgcc
gaacgcctatcttcgctccctgcccactccaacagcacttctaccccggcctcgagcgtg
aacactcccgatcccgatggcacgcccgccccggcgctccccgagtttctcaccgccgca
gaagaagcacagctggtaaccttctttacctcggagctgttgcgggcgggcgaccatgcc
gagatgtcggacgagatcaaggcgaccgcggccgccttcttccggagattctacgttaca
aatagcataatgacatacccaccccaggagatgttgatagtggccttgttctttggctgc
aaagccgaggggtccttcgtgagcatctcagattttgtcaagacgtttgggaaagataac
ccagaagaagtcctggcgggcgagttcctactctgccaaggccttcggttcgccatcgac
gtgaagcaccccttccgcgccctgcgcggggccttgatggagctcgccgctctccccgac
attgaccgagcccgcctgggtgcggcagagacccgtgctcgcgaaatcctgcgcttcagc
cccctcatcacggacgcctacttccactacacccccagccagatcatgcttgccgcgctc
tccctcgcagaccgcggcctcgccgagcgcctcataacaaagacctttcaccacgtctcc
ccgccccccgactccggcgccgacacgccttctgcttccgggaccgactccgggggcgcc
gccgccccttccaagacgcctgccgtccgccccggcgaagacaaagcgcaaatcatcggc
tcccacctccgcgataaagtcctcggaaccatcgaagcctgccgggaaatgctggcgaag
gagcttcccgagaggagggaacactggacaaataaagccgtgatcaaggcgcagatcacc
cctctccgcaagaagctcaacaagtgtcgcgacccggagcgctggaacttgatcgagctg
cagcggacgcggcgccagcaggcctcaaagaaggccgactccgaagacgatgatcccgat
gaccgcaaagacggtggcaacacgttgcagagcgacgcggccgtgtttggggagccgctg
gctgcctcgcgggataataagcggaggaaggtccaagggaacgggacagggctggatgat
cctttcggaggccctttgtga

DBGET integrated database retrieval system