KEGG   Myceliophthora thermophila: MYCTH_2301751Help
Entry
MYCTH_2301751     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
mtm  Myceliophthora thermophila
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mtm03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mtm03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(3482006..3482293,3482435..3482821,3482895..3483048,3483122..3483573))
Genome map
AA seq 426 aa AA seqDB search
MATEDERYRQSSQYQLWSFSPAQLAEMREKTNAAARARIAERLSSLPAHSNSTSTPASSV
NTPDPDGTPAPALPEFLTAAEEAQLVTFFTSELLRAGDHAEMSDEIKATAAAFFRRFYVT
NSIMTYPPQEMLIVALFFGCKAEGSFVSISDFVKTFGKDNPEEVLAGEFLLCQGLRFAID
VKHPFRALRGALMELAALPDIDRARLGAAETRAREILRFSPLITDAYFHYTPSQIMLAAL
SLADRGLAERLITKTFHHVSPPPDSGADTPSASGTDSGGAAAPSKTPAVRPGEDKAQIIG
SHLRDKVLGTIEACREMLAKELPERREHWTNKAVIKAQITPLRKKLNKCRDPERWNLIEL
QRTRRQQASKKADSEDDDPDDRKDGGNTLQSDAAVFGEPLAASRDNKRRKVQGNGTGLDD
PFGGPL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaagatgagcggtaccgtcagtcgtcgcagtaccagctgtggtctttctcg
cccgcccagctggccgagatgcgagagaagaccaacgcggcggctcgcgcgcgaatcgcc
gaacgcctatcttcgctccctgcccactccaacagcacttctaccccggcctcgagcgtg
aacactcccgatcccgatggcacgcccgccccggcgctccccgagtttctcaccgccgca
gaagaagcacagctggtaaccttctttacctcggagctgttgcgggcgggcgaccatgcc
gagatgtcggacgagatcaaggcgaccgcggccgccttcttccggagattctacgttaca
aatagcataatgacatacccaccccaggagatgttgatagtggccttgttctttggctgc
aaagccgaggggtccttcgtgagcatctcagattttgtcaagacgtttgggaaagataac
ccagaagaagtcctggcgggcgagttcctactctgccaaggccttcggttcgccatcgac
gtgaagcaccccttccgcgccctgcgcggggccttgatggagctcgccgctctccccgac
attgaccgagcccgcctgggtgcggcagagacccgtgctcgcgaaatcctgcgcttcagc
cccctcatcacggacgcctacttccactacacccccagccagatcatgcttgccgcgctc
tccctcgcagaccgcggcctcgccgagcgcctcataacaaagacctttcaccacgtctcc
ccgccccccgactccggcgccgacacgccttctgcttccgggaccgactccgggggcgcc
gccgccccttccaagacgcctgccgtccgccccggcgaagacaaagcgcaaatcatcggc
tcccacctccgcgataaagtcctcggaaccatcgaagcctgccgggaaatgctggcgaag
gagcttcccgagaggagggaacactggacaaataaagccgtgatcaaggcgcagatcacc
cctctccgcaagaagctcaacaagtgtcgcgacccggagcgctggaacttgatcgagctg
cagcggacgcggcgccagcaggcctcaaagaaggccgactccgaagacgatgatcccgat
gaccgcaaagacggtggcaacacgttgcagagcgacgcggccgtgtttggggagccgctg
gctgcctcgcgggataataagcggaggaaggtccaagggaacgggacagggctggatgat
cctttcggaggccctttgtga

DBGET integrated database retrieval system