KEGG   Myceliophthora thermophila: MYCTH_2301807Help
Entry
MYCTH_2301807     CDS       T02231                                 

Definition
histone acetyltransferase ELP3-like protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCTH_2301807
Transfer RNA biogenesis [BR:mtm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MYCTH_2301807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(3563084..3564510,3564569..3564860))
Genome map
AA seq 572 aa AA seqDB search
MATTTVTTTIRKKDANLPPENERFLRCCADIASALIEDHEASKDPSRPRKDINLNTLRSK
FAKKHKINNVPPLTAIIAAVPEHYKKYILPRLIAKPIRTSSGIAVVAVMCKPHRCPHIAY
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKALGHSVDK
VEYIIMGGTFMSLPESYRDEFISQLHNALSGYGTLNVDEAVRAGEQSSIKCVGITIETRP
DYCLQPHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSH
MMPDLPNVGMERDLYQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNG
LIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTR
EVGVNEVKHKIRPNQIELVRRDYTANGGWETFLAYEDPKQDILIALLRLRKCSEKYTFRE
ELVGQPTSLVRELHVYGMAVPVHARDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVIS
GVGVRSYYAKLGYWLDGPYMSKWLDGRPGPGE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaacgacggtgacgacgacgatccgcaagaaagacgcaaacctcccacccgaa
aacgagcgcttcctgcgatgctgcgccgatatagccagcgccttgatcgaggatcatgag
gcctccaaggacccaagccgtcctagaaaggacatcaacctcaacacgctgcgatccaaa
tttgcaaagaagcacaagatcaataatgtgccgccgctcactgccatcatcgctgcggtg
cccgaacactacaagaaatacatcctaccaagactgattgccaaaccaattcgtacgtca
tccggtatcgctgtggtcgcggtcatgtgtaaaccgcaccgatgccctcacattgcctac
acgggtaacatctgcgtctactgccccggcgggccggattcggactttgagtacagcaca
cagtcgtacacgggctatgagccgacgtccatgcgggccatccgggcccggtacgaccca
tttgaacaggctcgcgggcgagtcgaccaactcaaggctttgggacactcagtggacaag
gtggaatatatcatcatgggcgggaccttcatgtcccttccagaatcgtacagggatgag
tttatctcccaactccacaacgccctgagcggatacgggacgttgaacgtggatgaggcc
gtccgggctggcgagcaaagcagcatcaagtgcgtgggcatcaccattgaaaccaggcca
gattactgcctgcagccacacctatccagcatgctccgctacggttgcactcgcctcgag
atcggcgtccagtccctctacgaagacgtcgcgcgtgacacgaaccggggccacacagtg
gcagccgtcgcggaaactttctgccttgccaaggacgccgggttcaaggtggtcagtcac
atgatgcctgacttgcccaatgtcggcatggagcgcgacctgtaccagttcagggagtat
ttcgagaaccccgccttccggacggacggcctcaagatctacccgacgctcgttatccgc
ggcacggggctatacgagctctggcgcacgggccggtaccagaactatacgcccaacggg
ctgatcgacctggtggcgcgtatcctcgcgctggtcccgccatggacgcgcatctaccgc
gtacagcgcgacatccccatgccgctggtgacgtcgggcgtcgagaacggcaacctgcgc
gagctggcgctggcgcgcatgaaggactttggcaccacctgccgcgacgtgcgcacgcgc
gaggtcggcgtcaacgaggtcaagcacaagattcggccaaaccagatcgagctcgtgcgc
cgcgactacaccgccaacggcggctgggagaccttcttggcctacgaggaccccaagcag
gacatcctgatcgcgctcctgcggctgcgcaagtgcagcgagaagtacacgttccgcgag
gagctggtcggccagccgacgagcttggtgcgcgagctgcacgtgtacggcatggcggtg
ccggtgcatgcgcgcgacccgcgcaagttccagcaccagggctttgggacgctgttgatg
gaggaggcagagcggattgcgcgggaggagcacgggagcgagaagatcagcgtcatttcc
ggcgtgggtgtgaggagctactatgccaaactggggtattggctggatgggccgtatatg
agcaagtggctggacgggaggccgggaccgggggagtaa

DBGET integrated database retrieval system