KEGG   Myceliophthora thermophila: MYCTH_2302065Help
Entry
MYCTH_2302065     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2302065
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MYCTH_2302065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(3997237..3998220,3998325..3998338,3998395..3998416))
Genome map
AA seq 339 aa AA seqDB search
MSGGWNTIESDAGVFTYLLDNLGVKDVQFEELLSLNPDALAQLYPVYGVIFLFKFPTDAP
YRAGDKPLDGTFDQDAAERLFFAAQTIQNACGTQALLSVLLNKTPDNTASPSGSDDDDDE
TIDIGPELTSFREFTMALPPEYRGEALSNSELIRDVHNSFARSSPFVDETQRGPDEAGED
AFHFIAYTPIGGTLYELDGLQPAPISHGPCTRDEFPRKVMDVLQRRIARYDATEIRFNLL
AMVRDLRIRAREIGDFELLAREERKRRDWQFENALRRHNFVGFAGEVLKGVVAAKLKEGD
GAYERWVDQGRQKMQRRIEERKKSGAGGGGSGEDVEMAG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggttggaacaccatcgaatccgatgcaggcgtcttcacgtacctgttggat
aacctcggcgtaaaagacgtccagttcgaggagctcctctcgctcaacccggacgcgctc
gcccagctgtaccccgtctacggcgtcatcttcctcttcaagttccccaccgacgcaccc
taccgcgccggcgacaaacccctcgacggcaccttcgaccaagatgccgccgagcgcctc
ttcttcgcggcgcagaccatccagaacgcctgcggcacgcaggccctgctcagcgtgctc
ctcaacaagaccccggacaacacggcctccccgagcggcagcgacgacgacgacgacgag
accatcgacatcggcccggagctgacctccttccgcgagttcaccatggccctgccgccc
gagtaccgcggcgaggccctctcgaacagcgagctgatccgcgacgtgcacaacagcttc
gcgcggtcgtcaccctttgtcgacgaaacccagcgcgggcccgacgaggccggcgaggac
gccttccacttcatcgcctacaccccgatcggcggaaccctgtacgagctcgacggcctg
cagcccgcgcccatcagccacggcccctgcacgcgagacgagttcccgcgcaaggtcatg
gacgtcctgcagcggcgcatcgcccgctacgacgcgaccgagatccggttcaacctgctc
gccatggtgcgcgacctgcggatccgcgcccgcgagatcggcgattttgagctgctggcc
agggaggagcggaagcggagggactggcagttcgagaacgccctgcggcggcacaacttt
gtcggcttcgccggggaagtgctcaagggggttgtcgcggccaagctcaaggaaggggac
ggggcgtacgagaggtgggtggaccagggcaggcagaagatgcagaggaggatagaggaa
cgcaagaagagcggtgctggcggcgggggctcaggagaggatgtggagatggctgggtag

DBGET integrated database retrieval system