KEGG   Myceliophthora thermophila: MYCTH_2302089Help
Entry
MYCTH_2302089     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mtm  Myceliophthora thermophila
Brite
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MYCTH_2302089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4049276..4049286,4049351..4049685,4049751..4049824,4049910..4049962,4050037..4050088))
Genome map
AA seq 174 aa AA seqDB search
MGNTTSAVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGNNLKDQQLQQIVDKTIMEADKDNDGKISFEEFAAVVEATDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacaacgagcgcggtgctggacaacattgtccaagggtcgaacttcgacagg
gaggaggttgacagactacggaagaggttcatgaagctggataaggacaactcgggcacg
atcgagcgcgaagagttcctcagcctgccgcaaatatcctcgaacccgctggcaacgaga
atgatagccatctttgacgaggacggcggtggagacgtcgatttccaggagtttgtgtcc
gggctgagcgccttcagcagcaagggcaacaaggagcagaagctgcggttcgcgttcaag
gtgtacgatatcgaccgcgacggctacatcagcaacggggagctcttcatcgtgctcaag
atgatggtgggcaacaacctcaaggaccagcagctgcagcagattgtcgataagaccatc
atggaggcggacaaggacaatgacggcaagattagcttcgaggagtttgccgccgtggtg
gaagcgaccgatgtcagcatgagcatgactctggatcaattctag

DBGET integrated database retrieval system