KEGG   Thermothelomyces thermophila: MYCTH_2302089Help
Entry
MYCTH_2302089     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mtm  Thermothelomyces thermophila
Brite
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MYCTH_2302089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 Asp_Glu_race_2
Motif
Other DBs
NCBI-GeneID: 11510836
NCBI-ProteinID: XP_003662031
JGI: 2302089
UniProt: G2QAZ4
Position
2:complement(join(4049276..4049286,4049351..4049685,4049751..4049824,4049910..4049962,4050037..4050088))
Genome map
AA seq 174 aa AA seqDB search
MGNTTSAVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGNNLKDQQLQQIVDKTIMEADKDNDGKISFEEFAAVVEATDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacaacgagcgcggtgctggacaacattgtccaagggtcgaacttcgacagg
gaggaggttgacagactacggaagaggttcatgaagctggataaggacaactcgggcacg
atcgagcgcgaagagttcctcagcctgccgcaaatatcctcgaacccgctggcaacgaga
atgatagccatctttgacgaggacggcggtggagacgtcgatttccaggagtttgtgtcc
gggctgagcgccttcagcagcaagggcaacaaggagcagaagctgcggttcgcgttcaag
gtgtacgatatcgaccgcgacggctacatcagcaacggggagctcttcatcgtgctcaag
atgatggtgggcaacaacctcaaggaccagcagctgcagcagattgtcgataagaccatc
atggaggcggacaaggacaatgacggcaagattagcttcgaggagtttgccgccgtggtg
gaagcgaccgatgtcagcatgagcatgactctggatcaattctag

DBGET integrated database retrieval system