KEGG   Myceliophthora thermophila: MYCTH_2302176Help
Entry
MYCTH_2302176     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCTH_2302176
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2302176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4159789..4159901,4159966..4160413,4160470..4160896,4160954..4161111,4161173..4161822,4161882..4162824,4162886..4163348,4163404..4163551,4163608..4163764,4163982..4163984))
Genome map
AA seq 1169 aa AA seqDB search
MDDNQTPGAASPNVMMVDAPEEHVVHTNGTEPEDVAIINPDSMDTDAPLLASDYEAMKQH
VLPPLPEEPRVLDDQVHTWTVEGWRSLLKKEHGPIFYAGGYPWRILLFPFGNNVLDQCSI
YLEHGFEANNVPEDWSCCVQFALVLWNKNHPHIFFQHSAHHRFTKEESDWGFTRFLETRK
MFNPVWENADRPLIENECANISAYVRVVEDETGVLWHNFNNYDSKKETGYVGLKNQGATC
YLNSLLQSLYFTNAFRKAIYRIPTQEDESMQNSAYTLQRLFYQLQTSNTAVGTNELTKSF
GWETRHIFEQQDVQELSRKLMERMEEKMKGTEFEKALPQLFSGKIKTYISCINVPYESSR
IEDFWDVQLNVSGNENLLESFQDYIQVEKLDGENQYFAGDQYKLQDANKGVIFQSFPDVL
HLQLKRFQYDIQRDAMMKINDRYEFPEEFDASLYLDKDADKSEPWEYQLHGVLVHSGDLN
AGHYYAFIKPNKEGWWYKYDDDKVTKATKREVLEENFGGPFKLPNGQMRPLGNKKGPIMR
PNSAYMLVYIRKSRLDKVLCPVTEEDTPEHLRRRFAEEYALREARRKEREEQHLYLWVKA
ITEATFQQHGSTDLTNFDATPDTDPAAPRFYRLLRTAPMQELVNQIAADIGQDPKHVRLW
IMVNRQNKTVRPDQPVMDLRPTVEETYNRAAAHRDQALRVWVEVAEEFNADGTAVWPTYA
PGLANGAVVKNDLILLFLKRFDADAQELRGVGHVYMSKEKKVEELIPVIMKKMGWDKLSS
DEKIQLWEEIKPNMIEGLRGKQSLKAAELQDGDIICFQRIHERKPKLSLGDKNDKQSSEE
VKSLDRSEDAREYYDFLLHRRVVWFRAHPQKCDAETYKDFEMVLNSKISYDKLSEKVGEK
LGVEPTHLRFYTVNASSGNPRAAVKRGQNQTLQNILVPAGYGQLNMNQRNDALFFEVLEM
SLAELDTKKSIRITLLSEGITKEEQFDVLVPKNGQVKDLIGCLTAKAKIPSEEEGGPIRV
YEVSNHKFFRELERTYPVISINDYTTVIAERIPPEEVEAEDPRDFISVFQFHGEPSKAHG
IPFRFLLKEGEVFSETKKRLEKRTGLKGKSFEKIKFAVVRRAQFSRPQYLNDDDCLWEVA
ANPDDSLGLDHPDRTRAVRNGAGDLFLKG
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaccagacccccggtgccgcgtcacccaatgtcatgatggtcgacgcgccg
gaggagcatgtcgtccacacgaatggcaccgagcccgaggacgtcgccatcatcaacccc
gacagcatggatacagacgcacccctcctcgcaagcgactatgaggcgatgaaacagcat
gtgctgccgccgctgccagaagaacccagagtcctggacgatcaggttcacacatggacg
gtcgagggatggcggtcattactcaagaaggagcatggtccgatattttacgccggcggt
tacccatggcgaatcctcctcttcccgttcggtaacaacgtccttgaccaatgctccatc
tatctcgagcacggcttcgaagcgaacaacgtcccggaggactggagctgctgcgtgcag
tttgcgctcgtgttgtggaacaagaaccacccgcatatcttcttccaacattccgcccac
catcgcttcacaaaggaggagagcgattggggtttcacgaggtttctcgagacccgcaag
atgttcaatcccgtctgggagaatgcggaccggccgcttatcgagaacgagtgtgccaac
atcagcgcatacgtccgggtcgttgaggacgagactggcgtcttgtggcacaacttcaac
aactacgactcgaaaaaggagactggttatgttggcctcaagaaccagggtgccacctgc
tacctgaactctctcctgcagtcattatacttcacaaatgccttccgcaaggctatctac
cggatccccacgcaggaggacgaaagcatgcaaaacagcgcgtacacgctgcagagactc
ttctaccaactgcaaacctccaacacggctgtgggaaccaacgagctcaccaagtccttt
ggctgggaaacgcgccacatctttgagcagcaagacgtgcaagagctctccaggaagctc
atggagcgcatggaagagaagatgaagggtaccgaattcgagaaggcgcttccacaattg
tttagcggcaagatcaagacgtacatctcttgcatcaacgtgccctacgagtctagccga
atcgaagatttttgggacgtccagctcaacgtgagcgggaacgagaaccttctggagagc
ttccaggactacattcaggtggagaagcttgatggggagaaccagtacttcgccggcgac
caatacaagctgcaggatgcgaacaagggcgtcatcttccagtcattccctgacgtcttg
catctgcagctcaagcgcttccagtacgatatacagcgcgacgccatgatgaagatcaac
gaccgctacgaattccccgaggagtttgacgcctcgctctacctggacaaagacgcggac
aaatcggagccttgggagtaccagctgcacggcgtcttggtgcacagcggcgacctcaac
gccggccattactacgcctttataaagccgaacaaggaaggctggtggtacaagtacgac
gatgataaagtcaccaaggcgacgaaacgggaagtgctcgaagaaaacttcggcggcccg
ttcaagttgcccaacggccaaatgcgcccccttggcaacaagaaaggccccatcatgagg
cccaacagcgcatacatgctggtgtacattcgcaagtccaggctcgacaaggtcctctgt
ccggtcaccgaagaggacactccggagcatcttcggaggaggttcgcggaggagtacgct
ctccgggaggcgcggcgcaaggagagggaagagcagcacttgtatctctgggtgaaggcc
atcacagaagccacgttccagcaacatggcagtactgacctcaccaattttgatgcgacg
ccagatacagatccggcagcgccaaggttttaccgcctgcttcgcaccgcgccgatgcag
gagctggtcaaccagatcgcggcggatatcggccaggatccgaaacatgttaggctttgg
atcatggtcaaccgtcagaataaaaccgttcggccggatcagcccgtcatggatctccga
ccgactgtcgaggagacgtacaaccgagcagcggcgcatagggatcaagcacttcgcgtg
tgggtcgaagttgctgaggaattcaatgccgacggcacggctgtgtggccgacatatgcc
cctgggctggcgaacggggctgtcgtgaagaacgacctcatcctgctcttcctcaaacga
ttcgacgcggacgcccaggagttgaggggtgttggccatgtttacatgagcaaggagaag
aaggttgaggagctgatcccagtcatcatgaagaagatgggctgggacaagctgtcaagt
gacgagaagatccaactctgggaggagatcaaacctaatatgattgagggcctcagaggg
aagcagtctctcaaggcggcagagctccaggacggagacatcatctgcttccagcggatt
catgagcggaagccaaagctgagtctgggcgacaagaacgacaagcaatcatccgaggag
gtaaaatcgttggaccgttctgaggatgcccgagagtactacgacttcctcctccatagg
cgggtcgtctggttccgcgcccatcctcagaaatgcgatgccgagacttataaggatttt
gaaatggttctgaactccaagataagctacgacaagctgtcagagaaggttggcgagaag
ttgggagttgaacccacgcatcttcgattttacacggtgaatgccagctccgggaaccct
agggcggcggttaagagaggccagaaccaaacactccagaacattctcgtcccggccggc
tacgggcaattaaacatgaatcagcgcaacgacgccttgttcttcgaggtgctggagatg
agcctcgccgagctagacaccaagaaaagcatcagaatcaccctcctcagcgagggaatc
acgaaggaggagcaattcgacgtcttggtgcccaagaacggtcaagtgaaagaccttatc
ggctgtttgactgcaaaggcgaagatccctagcgaggaagagggggggccgattcgggtc
tacgaggtcagcaaccacaagttcttccgagagctggagcggacctatcccgtcatcagt
atcaacgactacacgacggtgatagcggagcggataccgcccgaggaagtcgaggccgag
gacccaagggacttcatctcggtgttccagttccatggcgaacccagcaaggcgcacggc
atcccgttccgcttccttctcaaggagggcgaggtgttttcggagaccaagaagcggctc
gaaaagcggacgggactcaaaggcaagagcttcgagaagatcaaattcgctgtggtccgc
agggcgcaattctcaaggccgcagtacttgaacgatgacgactgcctctgggaggtggcc
gcgaacccggatgactcccttggcttggaccatcccgaccggacacgggcggtgcggaac
ggcgccggggacctgtttctcaagggctag

DBGET integrated database retrieval system