KEGG   Myceliophthora thermophila: MYCTH_2302215Help
Entry
MYCTH_2302215     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYCTH_2302215
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     MYCTH_2302215
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     MYCTH_2302215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4197325..4197944,4198130..4199167,4199346..4199535))
Genome map
AA seq 615 aa AA seqDB search
MGVPFVLEGMKSEANYPESRVLIIMTGGTICMQPSADGLVPMTGFLEKAMAPRPSFNDNS
DPSVKIHAYKNGVKLTLDSLRTPPSAYSRHIRYGVLEFQPLLDSSSISSTGWTEIAMTIK
ENYHIFDGFVILHGTDSLAYTASALSFMMSNLGKPVILTGSQASIFALQSDAVDNLLGSL
IIAGTFVIPEVCLFFHHTLFRGNRTTKVSASSFEAFDSPNCAPLAKVTSLGVDVNWGLVR
RPTSIAGFQVTKYLDTAHVACLRIFPGIKPEMVDSVLRVPDLRGLILETFGMGNAPGGVD
GSLTKVIRAAVERGIVVVNVSQCTNGFVSPVYAPATALGRAGVVFGHDLTTEAALTKLSY
LLALPGLTYEDVTAKMAQSLRGEMTEMTLPSFSHPAGTLDTAVNRLTAAETAFTALGYAI
RNGELRTVREILEGDEFNHQLLKRADYAGNTVVHLAAVGPEPLVLRELLTRGAGVHSRNR
AGNTPLYLAEKAGNAECVRLLKEAGAHLWLDNELKGEGSRMPSRGASRAVSPDRGGGRGA
AGAAPPSAAAATGAAPAAVDPKGTAEGGSGEVEAVVGKGDAGRDGHVGAEELGELAAQTE
PARVPLTGDTGKIVG
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgccgttcgtcttggaggggatgaaatcagaggccaactacccggagtcccgg
gtgctcatcatcatgacgggcggtacgatctgcatgcagccttcagccgatggcttggtt
cccatgacgggttttctcgagaaggccatggctcctcggccgtcattcaacgataactcc
gacccttcagtcaaaatccacgcctacaaaaacggcgtcaagctgaccctcgacagcctc
cgaacccccccgagcgcctactcgcgccacattcggtatggcgtcctcgagtttcagccc
ctactcgactcgagctccatctcgtccacgggctggaccgagattgccatgaccataaag
gagaactaccacattttcgacggtttcgtcatcctgcacggcaccgactcgctcgcttac
acggcgtcggcgctgtccttcatgatgtcaaacctcggcaagccggtgatcttgaccggc
tcccaggcctccatctttgccctgcaatccgacgccgtcgacaacctgctgggttctctc
atcatcgccggcacctttgtcatcccggaggtctgtctcttcttccaccacaccctcttc
cgcggtaaccgcacaaccaaagtgtcggcctcctcctttgaggccttcgacagccccaac
tgcgcgccgctcgccaaggtcacctcgctcggcgtcgacgtcaactggggcctggtccgg
cggcccactagcatcgccgggtttcaggtgaccaagtacctggacacggcgcacgtggcc
tgcctgcgcatcttcccggggatcaagcccgagatggtggattccgtgcttagggtaccg
gacctgcgcggcctgatcctcgagacgttcggcatgggcaacgcccccggcggcgtcgac
ggcagcctgaccaaggtcatccgcgccgccgtcgagcgcggcatcgtcgttgtcaatgtc
agccagtgcaccaacggcttcgtgtcgccggtctacgctcccgccaccgcgctcggcagg
gccggcgtggtgtttggacacgacctcactaccgaggcagccctgaccaagttgtcgtac
ctcctggcactaccgggcttgacgtacgaagacgtgacggccaagatggcgcagtcgctg
cgcggcgagatgaccgagatgacccttccgtccttctctcacccggcgggcactctggat
acggccgtgaacagacttactgcggccgaaacggccttcacggcgctcggctacgcgatc
cgcaacggcgagctgcgcacggtgcgcgagatcctcgagggggacgagttcaaccaccag
ctgctcaagcgggccgactacgcgggcaacacggtggtgcacctggccgccgtcgggccg
gagccgctcgtcctgcgcgagctgctcacgcgcggcgccggcgtgcactcccgcaaccgc
gccggcaacaccccgctgtacctcgccgagaaggcgggcaacgccgagtgcgtgcgcctg
ctcaaggaggccggggcccacctgtggctcgacaacgagctcaagggggagggcagccgg
atgccgagccgcggggcgagccgggctgtctccccagaccgtggtggcggtcgtggtgct
gctggcgctgctcctcctagcgctgctgctgctactggtgctgcccccgctgctgttgat
cccaaagggacggcggagggtggcagcggggaggttgaggctgtggttggcaaaggggat
gcggggagggatgggcatgttggtgcggaagagcttggtgaattggctgcccagaccgag
ccggctagggtaccgctaacgggggacacgggcaagattgttggctga

DBGET integrated database retrieval system