KEGG   Myceliophthora thermophila: MYCTH_2302228Help
Entry
MYCTH_2302228     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2302228
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCTH_2302228
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCTH_2302228
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCTH_2302228
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MYCTH_2302228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4208790..4208840,4208985..4210364)
Genome map
AA seq 476 aa AA seqDB search
MPLRAKLLSQQPASQRLMSTQQAYELFKPRDGDEPEDVIFNSLYGLRSIELNRPKKLNAL
NGSMIRKIAPRLLEWAKSDMANVIVMKGAGDKAFCAGGDVAQLAKWNKSGPEGQELSKEY
FAQEYQLDHLIATYNKPYIAFMDGITMGGGVGLSIHAPFRIATERTVFAMPETTIGFFPD
VGASFFLPRMPGYVGTYLALTSSRLTGANVFYAGIATHYLHSTSLPQLESRLAELRFSDF
DSLQNRLAAINATIEEFVTGLPHDEPILLGGELRRAIDRCFSHDSVDAILRALEKEKGAT
RQWAQETLETLHKRSPTAVHVALRQMRIGAKWSIRDTFIREHAIASKFMASHDFTEGVTA
LLIDKRPARWEPASLEDIPPEESAKLTEDFFLMPRNQPTLQLLTEANYDEYPYSDFGVPT
EEQVEKKVMLGTMTRAQIVDAFVKERNHKQGVKEVVEEILARKTTGGPKAVAKWVY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccgagccaagctgttgtcacagcagccggcgtcgcaacggctgatgtcgacg
caacaagcatacgagctcttcaagccccgcgacggtgacgagcccgaggatgtcatcttc
aacagtctatacggcctccggtcgatcgagctcaaccggccaaagaagctcaacgccctc
aatggctccatgatccgcaagatcgccccgcgcctgctcgagtgggccaagtcggacatg
gccaacgtcatcgtcatgaagggcgctggcgacaaggccttctgcgccggcggcgacgtc
gcccagctggccaagtggaacaagtccggccccgagggccaggagctgtccaaggagtac
ttcgcccaggagtaccagctcgaccacttgatcgccacctacaacaagccctacatcgcc
ttcatggacggcatcaccatgggcggcggtgtcggcctcagcatccacgctcccttccgt
atcgccaccgagcgcaccgtcttcgccatgcccgagaccaccatcggcttcttccccgac
gtgggcgcctccttcttcctgccccgcatgcccggctacgtcggcacctacctcgccctg
accagctcccgcctgacgggcgccaacgtcttctacgccggcatcgccacccactacctc
cactccacctcgctcccccagctcgagtcccgcctggccgagctgcgcttctccgacttt
gacagcctgcagaaccgcctggccgccatcaacgccaccatcgaggagttcgtcaccggc
ctcccccacgacgagcccatcctcctcggcggcgagctgcgccgcgccatcgaccgctgc
ttcagccacgacagcgtcgacgccatcctgcgcgcccttgagaaggagaagggcgccacc
cgccagtgggcccaggagaccctcgagaccctgcacaagcgctctccgaccgccgtgcac
gtcgccctccgccagatgcgcatcggcgccaagtggagcatccgcgacaccttcatccgc
gagcacgccatcgcctccaagttcatggcctcgcacgacttcaccgagggcgtcaccgcc
ctgctcatcgacaagcggcccgcccgctgggagcccgcctcgctcgaggacatccccccg
gaggagagcgccaagctgaccgaggacttcttcctcatgccccgcaaccagcccacgctg
cagctccttaccgaggccaactacgacgagtacccctacagcgacttcggcgtccccacc
gaggagcaggtcgagaagaaggtcatgctgggcaccatgacgcgcgcccagatcgtcgac
gccttcgtcaaggagaggaaccacaagcagggcgtcaaggaggtcgtcgaggagatcctg
gcccgcaagaccaccggcggacccaaggcggtcgccaagtgggtgtactaa

DBGET integrated database retrieval system