KEGG   Myceliophthora thermophila: MYCTH_2302228Help
Entry
MYCTH_2302228     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mtm01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mtm00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mtm00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mtm00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4208790..4208840,4208985..4210364)
Genome map
AA seq 476 aa AA seqDB search
MPLRAKLLSQQPASQRLMSTQQAYELFKPRDGDEPEDVIFNSLYGLRSIELNRPKKLNAL
NGSMIRKIAPRLLEWAKSDMANVIVMKGAGDKAFCAGGDVAQLAKWNKSGPEGQELSKEY
FAQEYQLDHLIATYNKPYIAFMDGITMGGGVGLSIHAPFRIATERTVFAMPETTIGFFPD
VGASFFLPRMPGYVGTYLALTSSRLTGANVFYAGIATHYLHSTSLPQLESRLAELRFSDF
DSLQNRLAAINATIEEFVTGLPHDEPILLGGELRRAIDRCFSHDSVDAILRALEKEKGAT
RQWAQETLETLHKRSPTAVHVALRQMRIGAKWSIRDTFIREHAIASKFMASHDFTEGVTA
LLIDKRPARWEPASLEDIPPEESAKLTEDFFLMPRNQPTLQLLTEANYDEYPYSDFGVPT
EEQVEKKVMLGTMTRAQIVDAFVKERNHKQGVKEVVEEILARKTTGGPKAVAKWVY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccgagccaagctgttgtcacagcagccggcgtcgcaacggctgatgtcgacg
caacaagcatacgagctcttcaagccccgcgacggtgacgagcccgaggatgtcatcttc
aacagtctatacggcctccggtcgatcgagctcaaccggccaaagaagctcaacgccctc
aatggctccatgatccgcaagatcgccccgcgcctgctcgagtgggccaagtcggacatg
gccaacgtcatcgtcatgaagggcgctggcgacaaggccttctgcgccggcggcgacgtc
gcccagctggccaagtggaacaagtccggccccgagggccaggagctgtccaaggagtac
ttcgcccaggagtaccagctcgaccacttgatcgccacctacaacaagccctacatcgcc
ttcatggacggcatcaccatgggcggcggtgtcggcctcagcatccacgctcccttccgt
atcgccaccgagcgcaccgtcttcgccatgcccgagaccaccatcggcttcttccccgac
gtgggcgcctccttcttcctgccccgcatgcccggctacgtcggcacctacctcgccctg
accagctcccgcctgacgggcgccaacgtcttctacgccggcatcgccacccactacctc
cactccacctcgctcccccagctcgagtcccgcctggccgagctgcgcttctccgacttt
gacagcctgcagaaccgcctggccgccatcaacgccaccatcgaggagttcgtcaccggc
ctcccccacgacgagcccatcctcctcggcggcgagctgcgccgcgccatcgaccgctgc
ttcagccacgacagcgtcgacgccatcctgcgcgcccttgagaaggagaagggcgccacc
cgccagtgggcccaggagaccctcgagaccctgcacaagcgctctccgaccgccgtgcac
gtcgccctccgccagatgcgcatcggcgccaagtggagcatccgcgacaccttcatccgc
gagcacgccatcgcctccaagttcatggcctcgcacgacttcaccgagggcgtcaccgcc
ctgctcatcgacaagcggcccgcccgctgggagcccgcctcgctcgaggacatccccccg
gaggagagcgccaagctgaccgaggacttcttcctcatgccccgcaaccagcccacgctg
cagctccttaccgaggccaactacgacgagtacccctacagcgacttcggcgtccccacc
gaggagcaggtcgagaagaaggtcatgctgggcaccatgacgcgcgcccagatcgtcgac
gccttcgtcaaggagaggaaccacaagcagggcgtcaaggaggtcgtcgaggagatcctg
gcccgcaagaccaccggcggacccaaggcggtcgccaagtgggtgtactaa

DBGET integrated database retrieval system