KEGG   Myceliophthora thermophila: MYCTH_2302711Help
Entry
MYCTH_2302711     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCTH_2302711
Enzymes [BR:mtm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MYCTH_2302711
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C44
   MYCTH_2302711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4863918..4863957,4864041..4864429,4864495..4865490,4865570..4865718,4865779..4865814,4865872..4865898,4865984..4866009,4866079..4866129,4866299..4866324))
Genome map
AA seq 579 aa AA seqDB search
MCGIFACHNHPDVVKFKPTALKLSKAIRHRGPDWSGSVTCHNTILCHERLSIVGVESGAQ
PLTNADESIILAVNGEIYNHRLIRKSLKKPYHFKTASDCEVIIPLYMEHGLDAPKHLDGM
FSFVLYDKNLDRIIAARDPIGITTLYQGWSSEQPGTVYFASELKALHPVCDKIESFPPGH
IYDSATGERIRYFQPSWWDGQRIPEKPADLKLLRETLEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRETKRLRKLAEEANGSAFEQTGDADRGEGLVGIDDENKLSTMTFLPQLNSF
SIGLPGSPDNEAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLETYDVTTIRASTPMY
LLSRKIKAMGIKMVLSGEGSDEIFGGYLYFHGAPNKAAFHEECVRRVKNLHLADCLRANK
STSAWGLEARVPFLDKEFLEVSMNIDPQEKMITSERLEKYILRKAFDTSDEPDTEPYLPE
SILWRQKEQFSDGVGYGWIDALKEHAERHVTDEMMKNPKPEWGSDIPDTKEAYWYRLMFD
EHFPPSCASTVMRWTPKWSKQTDPSGRAIPIHKAKYNDA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcttcgcctgccacaaccacccggatgtggtcaagttcaagccgactgct
ctgaaactctccaaggcaattcggcatcggggacccgattggagcggcagtgtcacctgc
cacaacacaattctgtgccatgagcgtctcagcatcgtcggcgttgaaagtggagcgcag
ccactcaccaacgccgatgagagcattatcctggccgtcaatggcgagatttacaaccat
cgtctgatccggaagagcctgaagaagccataccacttcaagactgcctcggactgcgag
gtcattattcctctgtatatggaacacggtctcgatgcgcccaagcacctcgatggcatg
ttctccttcgtcttgtacgacaagaacctggaccgcatcatcgccgcccgcgatccgatc
ggcatcaccaccctttaccagggctggtcgtccgagcaacccggcaccgtctactttgcc
tccgagctcaaggctctgcaccccgtgtgcgacaagatcgaatcgttcccgcctgggcac
atctacgacagcgcgaccggtgagcggatccggtatttccagccgtcatggtgggacggc
cagaggatcccggagaagccggcggatctgaagctgctgcgcgagacgctcgagaagtcg
gtcaggaaacgtctcatggccgaggtcccgtacggtgtcctgctttccggcggcctggat
tccagcctggttgcgtccattgcccagcgggagacgaaacggctacggaagctggcagag
gaggccaacggcagcgcctttgagcagacgggcgatgcggaccggggcgaaggattggtt
ggcattgacgacgagaacaagctgtcgaccatgaccttcctgccccagctcaactccttc
tcgatcggtctccccgggtcgcccgacaacgaggcggcgctcgaggtcgccaagttcctc
ggtaccaagcatcacgtcatgaccttcacgattgaggatggcctcaacgcgctttcggac
gtcatctaccacctggagacgtacgacgtgaccaccatccgcgcctccacgcccatgtac
ctgctctcgcgcaagatcaaggccatgggtatcaagatggtactcagcggcgagggcagt
gacgaaatcttcggcggctacctgtatttccacggcgcgcccaacaaggccgccttccac
gaggagtgcgtgcgcagggtgaagaacctgcatctcgctgattgcctgcgcgccaacaag
tcgacttcggcctggggtcttgaggcccgcgtgcccttcctggataaggagttccttgag
gtctccatgaacattgacccccaggagaagatgatcacgtccgagaggcttgagaagtac
attcttcgcaaggccttcgacaccagcgatgagcccgacacggagccgtacctccctgag
agcatcctttggcgccagaaggagcagttctcggacggcgttggctacgggtggatcgat
gctctcaaggagcatgccgagcggcacgtcaccgacgagatgatgaagaaccccaagccc
gagtggggctcggatatcccggataccaaggaggcgtactggtaccgcctcatgttcgac
gaacacttcccgccgtcgtgcgcctcgaccgtcatgcggtggacccctaagtggtccaag
cagactgaccccagtggccgggccatccccatccacaaggccaagtacaacgatgcttaa

DBGET integrated database retrieval system