KEGG   Myceliophthora thermophila: MYCTH_2302790Help
Entry
MYCTH_2302790     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCTH_2302790
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2302790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4972608..4973288,4973350..4974183,4974251..4974357,4974413..4974575,4974626..4975693)
Genome map
AA seq 950 aa AA seqDB search
MGPAPAGGPLPRRGGRPQHYPPAHAYHHGHHSHHNHPQPHVSQPMYPAGYMAAPYAGAHY
YMPPPYQNGAMPGPAGYMPYPNPGYVRSPPAMQHFVPMQQSYGRPPQHSPIVSSPYHPPP
PAAAPVVPPMPHTPSSTHSHVLPPPMTPPVQQFHETAVQPQMPVPVQLPPQPQPEQPPQS
EPQPGSRPVSQQEAYPPPPPPQQASEPATKPSPTPSVQPPRQPFRPPLPWLSQPDLPFPQ
RTSKLRRRKKHLGADAERVELPGQHAPTTDAPVEDPVARQPSEDAQQAGGSTPKAESKTE
APATRSETPSTQDQPSEPAVSSAPTTPSSAQPPKVSAATPSTPAGVKPAVPAVPVVPALP
KASPKEAKSSAAVEKAAPARAQAAVAPAEQPAEAAKLAGEKVDGSAEVAQPAPAWSKPKL
WTGLFSKPGSSVASTSSAAAAAQAQTNGNTAEGSTVVPGPGGFAKANANSLAQALQAYRP
GIPDRLAFLEPRGLVNTGNMCYMNSVLQVLIFCIPFLDFLDQVSKKAAHSFKSETPLLDA
MIMFMREFKVIDSATSAEQLRKRLKSEEYEKFGEPFTPEFVYDAIRTLPRFASMRRGHQQ
DAQEFLGFLLEGLHDECVQVMRTVPASTASTAPNSSLPSPTSSRANDASEGGDDWLEVGP
RQRSAVTRSSGHSNTLSPITKIFGGQLRSELRVPGNKNSVTLEPYQPLQLDIGSPEVRNI
IDALKGLTRPEVLHGDFNSPHGKDVRATKQVFIESVPPVLILHLKRFQFDAEGYGGTVKI
WKKVGYPLEFEFPREVLSRQTRNSILAENSGTPRYRLIAVVYHHGKNASGGHYTVDVRRQ
DGREWIRIDDTVIRRVRDEDVAESGAEEDAGKIDGRRDAGAAASGNRFLGIDDEDTGDDD
GWKQAAGGKKWSSVVNGASTASSNGQKAKQQHKESMKENKVAYLLFYQRI
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgcgcccgccggcggtcctctacctcgccgcggcggccggccccagcactac
cccccagcccacgcctaccaccacggccatcacagtcaccacaaccatccacaaccacat
gtcagccagccaatgtatcccgccggctacatggccgccccctacgccggcgcccactac
tacatgcctccgccctaccagaacggcgccatgcccggcccggccggctacatgccctat
cccaacccaggatatgtccggtcgcctcccgcgatgcagcacttcgtaccgatgcagcag
tcgtatggccgccccccgcaacactcccccattgtctcttcaccctaccaccccccacct
cccgccgccgcgcccgtcgtcccgcccatgccacacactccgtcctccacccactctcac
gtcctcccgcctcctatgactcctccagtccagcagtttcacgagactgctgttcaaccc
cagatgcccgttccagtgcaactccctcctcagccccagccggagcagcctcctcagtcc
gagccccagcctgggtcgcgcccggtgtcgcagcaagaggcgtatcccccccctccccct
cctcagcaggcgtccgaacctgccaccaagccatccccgactccctctgtccagccgccc
agacagcctttcaggccaccgctcccctggctctctcagcctgatcttcccttcccccaa
cgcacatcgaagctgaggaggagaaagaagcaccttggcgctgatgccgagagagtcgag
ttgcccggacagcacgcacccactactgacgctcccgtcgaagacccggtggctcggcaa
ccttcggaggatgcgcagcaagccggtggttctaccccgaaagcggagtccaagaccgag
gcccccgccacccggtctgagacaccttccacccaagatcagccctccgagcccgctgtt
tcgagcgcaccaaccacaccgagttctgcgcagccgcccaaggtgtctgccgctacccca
agcactccggccggcgtgaagcctgcggtacccgcagttcccgttgtccctgcgttgccc
aaggcgagcccgaaagaggccaagtcatcggctgccgttgagaaggcggcccctgccagg
gcccaagccgccgtcgcccctgccgaacagccggccgaggccgccaagctggctggggag
aaggtggatgggagcgccgaggttgcccagccggcacctgcctggtccaagccgaagctt
tggacgggtcttttttccaagcctggcagctctgtcgcaagcacaagctctgcagccgct
gccgcccaggcgcagaccaacggcaacacggcagagggttcgaccgtggtgcccggaccc
ggcggcttcgccaaggccaacgcgaactcgctcgcgcaggccctgcaagcctaccgcccc
ggcatccccgaccggcttgccttcctagagccgaggggtctcgtgaataccggtaatatg
tgttatatgaattcggttttgcaagttctcatcttttgcattcctttcttggacttcctc
gaccaagtcagcaagaaggccgcccacagtttcaagagcgagacgcctctgttggatgcg
atgatcatgttcatgcgcgagtttaaggtgatagactcggccacgtcggcggagcagctc
aggaagcgcctcaagagcgaggagtacgagaagttcggcgagcctttcacccccgagttc
gtttatgacgccatccggacgcttcctcgctttgcgagcatgaggcgcggtcatcaacaa
gatgcccaagaattcctcgggttcctcctcgagggtctccatgacgagtgcgtccaggtg
atgcgtacggtgcccgcttcgactgcatctaccgctcctaactcgtcacttccgtctccg
acctcgtcgagggcaaacgatgcctcagagggtggtgatgactggctcgaggttggtccc
cgtcagcggtccgccgtcacgcggtcctcaggtcactcgaatacgttgtcacccatcacc
aagatcttcggcgggcagctgcgctcggaactgcgcgtcccgggcaacaagaattctgtc
acgctcgagccataccagcctctgcagctcgacattggctctcctgaggtgcggaacatt
atcgacgccctcaagggcctcacgcgacccgaagtgctccatggcgacttcaactcaccc
cacggcaaggacgtccgggcgaccaagcaggtcttcatcgagtctgtgccgccggtcttg
atcttgcacctgaagcgcttccaattcgacgccgagggctacggcggcaccgttaagatc
tggaagaaggtcggttatccgctcgagttcgagttcccccgggaagtgctgtcgcgccag
acccgcaacagcatccttgcggagaactcgggcactcctcggtaccgtctgattgcggtc
gtctaccaccacggcaagaacgccagcggcggtcactacactgtcgacgtccgccgccag
gacggccgggaatggatccggattgatgacacagtcattcggcgggtgcgggatgaggat
gtcgccgagagcggcgccgaggaggacgccggcaagatcgacggccgaagagacgcgggc
gccgctgcctcgggcaaccgcttccttggaatcgacgacgaggacactggggatgacgac
ggctggaagcaggcggctggcggcaagaaatggagcagcgtcgtcaacggcgcgtcgacg
gcttcctccaacggccagaaagccaagcagcagcacaaggagagcatgaaggagaacaag
gtcgcttacctgctgttctaccagcgcatctga

DBGET integrated database retrieval system