KEGG   Myceliophthora thermophila: MYCTH_2302899Help
Entry
MYCTH_2302899     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mtm  Myceliophthora thermophila
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCTH_2302899
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCTH_2302899
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MYCTH_2302899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(5094596..5095206,5095301..5095615,5095706..5095772,5095847..5095979,5096089..5096201))
Genome map
AA seq 412 aa AA seqDB search
MADLQGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPYMSKKPFAQLFPNANPDALDLLDRMLAFDPT
RRISVEEALEHPYLAIWHDASDEPDCPTTFNFDFEVIDDVNEMRKMILEEVFRFRQLVRT
VPGSTPHAHAQPAAPGQVPMPSGGPNHQWKADEPRPEEYGTMQGLEAELGGR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctgcagggccgcaagatcttcaaggtcttcaaccaggacttcattgtcgat
gagagatacacggtgaccaaagagctggggcagggagcttatggcattgtctgcgccgcc
gtcaacaaccaaaccaacgagggtgtcgccatcaagaaggtcacaaatgtcttcagcaag
aagatcctcgccaagcgcgccctgcgcgagatcaagctcctgcagcacttccgggggcac
cgcaatattacctgtctgtatgacatggacatccctagacccgacaacttcaacgagaca
tacctctatgaggagttgatggagtgcgacctggcggccatcatccggtccggccagccg
ctaaccgacgcccacttccagtctttcatctaccagatcctgtgcggcctcaagtacatc
cactcggcgaacgtgctgcaccgcgatctcaaaccgggtaatctgctggtcaatgccgac
tgcgagctcaagatttgcgactttggcctcgctcgcggcttctcgatcgaccccgaggag
aatgccgggtacatgaccgagtacgtggcgacgcggtggtatcgcgccccggagatcatg
ctgagcttccaaaactacaccaaagcgatcgacgtctggtccgtgggttgcatcttggcc
gaactgctcggcggccgcccgttcttcaaaggccgcgactacgtcgaccagctgaaccag
atcctgcacatcctgggcacgccaaacgaggaaaccctctcccggatcggctcgccccgg
gcgcaggaatatgtccgtaacctgccctacatgtccaagaagccgttcgcgcagctcttc
cccaacgccaacccggacgcgcttgacctgctggaccgcatgctggccttcgacccgacg
cgccgcatctcggtcgaggaggcgctcgagcacccgtacctggccatctggcacgacgct
agcgacgagccggactgccccaccacgttcaacttcgactttgaggtcatcgacgacgtc
aacgagatgcgcaagatgatcctcgaggaggtcttccgcttccgccagctcgtccgcacc
gtccccggctcgaccccccacgcccacgcccagcccgccgcgcccgggcaggtgccgatg
ccgagcggggggcccaaccaccagtggaaggccgatgaaccacggccggaggagtacggg
actatgcagggtctggaggccgagctgggaggcagatga

DBGET integrated database retrieval system