KEGG   Myceliophthora thermophila: MYCTH_2303583Help
Entry
MYCTH_2303583     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
mtm  Myceliophthora thermophila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCTH_2303583
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCTH_2303583
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MYCTH_2303583
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     MYCTH_2303583
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     MYCTH_2303583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(987099..987421,987511..989503)
Genome map
AA seq 771 aa AA seqDB search
MPAASDIVDYSPHHPDPSPLIPTATNLILIDNYDSFTWNVYQYLVLEGANVTVFRNDKIT
LEELIAKKPTQLVISPGPGHPNTDSGISRDAIKYFAGKIPIFGVCMGQQCIFDVYGGDVS
FAGEILHGKTSPLSHDSKGVYAGLPQGLPVTRYHSLAGTHVTLPECLEVTSWIAKEDGSK
GVIMGVRHKEYTIEGVQFHPESILSAEGRVMLRNFLHLQGGTWAENERLQRATEGSKKAS
SAPDGDAKTAAKPKNNILQKIYAHRRAAVAAQKEIPSQRPSDLQAAYDLNLAPPRISLVE
RLRNSPFDVALAAEIKRASPSKGIFALDIDAPTQARKYALAGASVISVLTEPEWFKGSIE
DLRAVRRVLDGMPNRPAVLRKEFIFEEYQILEARLAGADTVLLIVKMLEPEVLERLYKYS
LSLGMEPLVEVQNSEEMAIAIKLGAKVIGVNNRNLESFEVDLGTTGRLRSMVPKDTLLLA
LSGINSHQDVLDCKRDGVNGILVGEAIMRAPDATKFIRELCAGPDAPAPESSSSAKPLLV
KICGTRSAEAAIEAVKAGADLVGMILVPGTKRCVSHETALAISEAVHSSKKAAPAATEAV
HVPQTATDFFALTGETLRKRAPLLVGVFMNQPLAEVLEKQRLYNLDVVQLHGDEPLEWAR
LIPVPVIRKFGPGQVGLGTRGYHAVPLLDSGAGSGQLLDVDAVKGALERDQGLSFLLAGG
LGPENVAQAVAALGPLAERVLGVDVSSGVEADRHQSLDKIREFVKAAKAIR
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgcttcggacatcgttgattactcaccacatcatcctgatccctcgcccctg
atcccaacagccaccaatcttatcttgatcgacaactatgactcctttacctggaacgtc
taccagtacctggtgctcgagggtgccaacgtgaccgtgttccgcaacgacaagatcaca
ctcgaggagctcattgcgaagaagccgactcaattggtcatcagtcccgggccaggtcac
ccaaacaccgactcgggcatcagccgcgatgcaatcaaatacttcgccggcaagattccc
atttttggtgtctgcatgggacaacaatgcatctttgatgtgtacggcggtgatgtgagc
ttcgccggggagattctgcacggcaagacgtcacccctgagccacgattccaagggtgtc
tatgccggcctaccccagggtctgcccgtgacccgttatcactcactggccggaacccac
gtcactctgcccgagtgtctcgaggtcacctcctggatcgccaaggaggatggctctaaa
ggggtcatcatgggtgtccgccacaaggaatacaccattgagggggtgcagttccacccc
gagagcatcctgtcggccgagggccgcgtcatgctgaggaacttcctgcacttgcaaggc
gggacatgggctgagaacgaacggctgcagagggccaccgaggggagcaagaaagcgtcg
agcgcgccggacggtgacgcgaagactgccgccaagccaaagaacaacattcttcagaaa
atttacgcccaccggcgggccgccgtggccgcccagaaagagattccctcccaacgtccc
tccgacctgcaggccgcctacgacctgaacctagcgccaccccggatctctctcgtcgaa
cgcctgcgcaactcgccgttcgatgtcgctctggcggcggagatcaagagggcgtcgcct
tcgaagggcatctttgcgctcgacatagacgcgcctacccaggcccgcaagtatgcgctc
gccggcgccagcgtcatctcggtgcttaccgaaccggagtggttcaagggcagcatcgag
gacctccgggcggtgcgtcgagtcctcgacgggatgccgaatcggcccgccgtgctccgg
aaggagttcatctttgaggagtaccagatcctggaggccaggctcgcgggcgccgacacc
gtgctgctgatcgtcaagatgctcgagcccgaggtcctggaacggctatacaagtactcg
ctgtcgctggggatggagccgctggtggaggtgcaaaacagcgaggagatggccattgcc
atcaagctgggagccaaggtcatcggcgtcaacaaccgcaacctagagagcttcgaggtc
gatctgggcaccaccggccggctgcggagcatggtgcccaaggataccctcctgttggct
ctcagcggcatcaactcccaccaggacgtcctcgactgcaagcgggacggcgtcaacggc
atcctcgtcggagaggccatcatgcgtgctccggacgcgaccaagttcatcagggagctg
tgcgccgggccggacgcgccggcgcccgagtcgtcgtcgtcggccaagccgctcctcgtc
aagatctgcgggacacggagcgccgaggccgctatcgaggccgtcaaagccggcgccgac
ctggtcggcatgatcctggtccccggtacgaaacggtgcgtctcccacgagacggcactc
gccatctcggaagccgtgcacagcagcaagaaggcggcgcccgccgccacggaagccgtc
cacgtcccccaaacggcgacggacttcttcgctctcaccggcgaaaccctccgcaagagg
gcgccgctcctggtgggagtcttcatgaaccagcccctggccgaggtgctcgagaagcag
cggctgtacaacctcgacgtggtccagctgcacggcgacgagccgctcgagtgggccagg
ctgatccccgtgcccgtcattcgcaagttcgggcccggacaggtcgggctggggacgcgc
gggtaccacgcggtgccgctgctggactcgggcgccgggtccgggcagctgctcgacgta
gacgcggtcaagggggcgctggagcgggaccagggcttgtccttcctgctggcgggcggg
ctggggccggaaaacgttgcccaggcggtggcggccctgggtccgctcgcggagagggtg
ctgggtgtggacgtgagcagcggcgtcgaagctgacaggcaccagagtctggacaagatt
agggagtttgtaaaggccgccaaggcgatccggtag

DBGET integrated database retrieval system