KEGG   Myceliophthora thermophila: MYCTH_2303755Help
Entry
MYCTH_2303755     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtm  Myceliophthora thermophila
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2303755
   01212 Fatty acid metabolism
    MYCTH_2303755
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCTH_2303755
   00650 Butanoate metabolism
    MYCTH_2303755
  Lipid metabolism
   00062 Fatty acid elongation
    MYCTH_2303755
   00071 Fatty acid degradation
    MYCTH_2303755
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCTH_2303755
   00310 Lysine degradation
    MYCTH_2303755
   00380 Tryptophan metabolism
    MYCTH_2303755
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCTH_2303755
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCTH_2303755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1322631..1323361,1323481..1323646))
Genome map
AA seq 298 aa AA seqDB search
MNVAAARVSALRGLRPVASRFQPSTLPQIARSFSASARRSYEYIEVSEPRPGVGQVTLNR
PKALNALCSPLIGELNTALREFQASPTVAAVVLTGSERAFAAGADIKEMAPLTFSEAYSK
SFIESWSDLTTALKKPLIAAVSGHALGGGCELALMADILYCTATANFGQPEIKLGTIPGA
GGSQRLTRAVGKSKAMELILTGKSFTGEEAERWGVAARVFPTYEALLEGALKTAETIAGY
SKVAVQAAKEVVNKSQDLALRDGVEYERRVFHALFGSQDQKIGMKAFAEKKKPEWSHQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagcagcagcccgcgtcagtgccctccgcggccttcggccggtggcttcccgc
ttccagccgagcactctcccgcagattgcccgctccttctcggcgtcggcccgtcgcagc
tacgagtatatcgaggtctctgagccgcgccccggcgttgggcaagtgaccctcaaccgt
cccaaggcgctcaacgcgctctgctccccgctcatcggcgagctcaacacggccctgcgc
gagttccaggcgtcgccgaccgtggccgccgtcgtgctcaccgggtcggagcgggccttc
gccgccggcgccgacatcaaggagatggccccgctgaccttcagcgaggcgtacagcaag
tcgttcatcgagtcgtggtccgacctgacgacggcgctcaagaagccgctcatcgccgcc
gtctcgggccacgccctcggcggcggctgcgagctcgccctcatggccgacatcctctac
tgcaccgcaacggccaacttcggccagcccgagatcaagctcggcaccatccccggcgcc
ggcggcagccagcggctgacccgcgccgtcggcaagagcaaggccatggagctgatcctg
acgggcaagtccttcaccggcgaggaggccgagcgctggggcgtcgccgcccgcgtcttc
cctacctacgaggccctcctggagggtgcgctcaagacggccgagaccatcgccggctac
tccaaggtggccgtgcaggcggccaaggaagtggtcaacaagagccaggacctggcgctg
cgggacggtgtcgagtatgagaggagggtcttccacgccctgtttggcagtcaggaccag
aagatcgggatgaaggcgtttgcggagaagaagaagcccgagtggagccatcaatag

DBGET integrated database retrieval system