KEGG   Thermothelomyces thermophila: MYCTH_2303933Help
Entry
MYCTH_2303933     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00670  One carbon pool by folate
mtm00790  Folate biosynthesis
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_2303933
   00670 One carbon pool by folate
    MYCTH_2303933
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MYCTH_2303933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 ARS2 YdfA_immunity TFIIA Pex14_N Presenilin
Motif
Other DBs
NCBI-GeneID: 11507468
NCBI-ProteinID: XP_003662842
JGI: 2303933
UniProt: G2QE14
Position
3:complement(1567665..1568522)
Genome map
AA seq 285 aa AA seqDB search
MPAANPLLPELTLIVAATQQMGIGRNGTLPWTGLRKEMAYFARVTKRLPPAPSQHPHQQQ
QHPHQQQQHPHQQQQHPHQQQQQSTGDGQQQQQQLVQNAVIMGRKTWESIPERFRPLPGR
WNVVISRKAAAAAARGGGSLGAPGGEENPVMAAGLEEALRYLGGRPGVGRVFVIGGAQIY
RAALETAQARRVLLTRVRTEFECDTFFPLRLDEANADADAAAAAADADADADADAVIATA
AAAAAKGWRRSGQEEMDAWVGEEVPRGVQAEAGTEYEFEMWERVD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgccaacccgctgctccccgagctcacgctcatcgtggcagccacccagcag
atgggcatcggccgcaacggcaccctcccctggaccggcctgcgcaaggagatggcctac
tttgcgcgcgtcaccaagcgcctcccacctgcgccgtcgcaacacccgcaccaacaacaa
caacacccgcaccaacaacaacaacacccgcaccaacaacaacaacacccgcaccaacaa
caacaacaaagcacgggggacgggcaacaacaacagcagcagctggtgcagaacgccgtc
atcatgggccgcaagacgtgggagagcatccccgagcggttccggccgcttccggggcgg
tggaacgtcgtcatctcgaggaaggcggcggcggcggcggcgcgggggggagggtcgctg
ggggcgccgggaggggaggagaatccggtgatggcggcgggcctggaggaggcgctgcgg
tacctcgggggccggcccggggtgggccgggtgtttgtgattggcggggcgcagatctac
cgggcggcgctcgagacggcgcaggcgcggcgggtgctcctgacgcgggtgcgtaccgag
ttcgagtgcgacaccttcttccccctcaggctggacgaggcgaacgccgatgctgatgct
gctgctgctgctgctgatgctgatgctgatgctgatgctgatgccgtcatcgccaccgcc
gccgccgccgccgccaaggggtggcggaggagcgggcaggaggagatggacgcctgggtg
ggcgaggaggtacccaggggggtgcaagccgaggcggggaccgagtacgagtttgagatg
tgggagagggtggattga

DBGET integrated database retrieval system