KEGG   Myceliophthora thermophila: MYCTH_2304075Help
Entry
MYCTH_2304075     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MYCTH_2304075
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MYCTH_2304075
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   MYCTH_2304075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1771805..1771832,1771950..1772324,1772462..1772715,1772821..1773840))
Genome map
AA seq 558 aa AA seqDB search
MHALGFLRRKRTRDGAQGHSSSSNPTSPVTPTANGFDQHPVPRGSRSSAGSQSTRHSSAT
ATQQQNRPAEAAAGQQEQEQEQAQEQKQEQEQEQAQEQPMNTLSPQQPPYAVAQQHTPSP
GTDPQNVPRIANLINPPHNEGQADYQQLQGAPSAQYTSSNGGVMSSHPHQQQQYHHHLHH
FNHHHHQEQQPQQQQTHEEQKQQQQQQQQQQQQQEQQQQQQQRPTQQVVTTQGEGRVTKG
KYSLEDFNILRTLGTGSFGRVHLVQSRHNHRFYAIKVLKKAQVVKMKQVEHTNDERRMLG
EVKHPFLVTLWGTFQDARNLYMVMDFVEGGELFSLLRRSGRFPNPVAKFYAAEVTLALEY
LHSRNIIYRDLKPENLLLDRHGHLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYN
KSVDWWSLGILIYEMLCGYTPFWDSGSPMKIYENILRGKVKYPAYINPDAQDLLERLITA
DLTKRLGNLYGGSQDVKNHPWFAEVTWDRLARKDIDAPYSPPVRAGTGDASQFDRYPEEV
EQYGAPGNDELGYLFQDF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccctcggcttccttaggaggaaacggactagggacggagcccagggccattcg
tcgtccagcaacccaacgagccccgtaacgccgacagcaaacggcttcgaccaacacccc
gtcccccgcggatcacgttccagcgccggctcgcagtctacacgccactcctcggcaact
gccactcaacaacagaatcggccggctgaagcggcggctgggcagcaggagcaggagcag
gagcaggcccaggagcagaagcaggagcaggagcaggagcaggcccaggagcagccaatg
aacaccctctcaccgcagcaaccgccgtacgcggtggcacaacaacacactccctctccc
ggtaccgatccgcagaatgtaccgcgcattgcgaatctgatcaaccccccgcacaatgag
gggcaagccgactatcagcaactccagggagccccaagtgctcaatacacttcaagcaat
ggcggtgtgatgtcaagtcatcctcatcagcagcaacaataccaccatcaccttcaccac
ttcaaccaccatcaccaccaggaacagcagccgcagcagcaacaaacacacgaggaacaa
aagcagcagcagcaacaacaacagcaacagcaacagcaacaagagcagcagcagcagcag
cagcaacgaccaacacagcaggtggtaacaacacagggcgagggccgggtgaccaagggg
aagtactcactcgaggattttaatatcctgaggacgctggggacgggcagcttcggccga
gtccacctggttcagtcgcggcataaccaccggttctatgcaatcaaggttctcaagaag
gcgcaggtggttaagatgaaacaggtggagcacaccaatgacgagcggaggatgctggga
gaggtgaagcacccgtttctggtcacgctgtggggcaccttccaggacgcgaggaacctg
tacatggtgatggactttgtcgagggcggcgaactcttctctctgttaaggaggtcaggg
cgcttccctaacccggtggccaagttctacgccgccgaagtaacgctggctctcgagtac
ctacactcgcgcaacattatttatcgcgacctgaagccggagaaccttctgctcgaccgg
cacggccacctcaagattacggattttggattcgccaagcgcgtaccagacaagacgtgg
acgctctgcggcacgccagattatctcgcgcccgaggtggtctccaacaagggctacaat
aaatcagtagactggtggtcccttggcatcctcatctacgagatgctctgcgggtacaca
cccttctgggacagcggttcgccgatgaagatctacgagaacatcctgcggggcaaagtc
aagtacccggcgtacatcaacccggacgcgcaggacctgctggagcggctcatcacggcc
gacctgaccaagcggctgggcaacctgtacggcgggtcgcaggacgtcaagaaccacccc
tggttcgccgaggtgacgtgggaccggctcgcacgcaaggatattgacgcgccttactcg
cccccggtgcgggccggcaccggcgacgccagccaattcgaccggtacccggaggaggtg
gagcagtacggcgcgccggggaatgacgaactcggttacctgttccaggatttctaa

DBGET integrated database retrieval system