KEGG   Myceliophthora thermophila: MYCTH_2304122Help
Entry
MYCTH_2304122     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mtm  Myceliophthora thermophila
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MYCTH_2304122
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     MYCTH_2304122
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     MYCTH_2304122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1852403..1852519,1852577..1852636,1852755..1853072,1853209..1853238))
Genome map
AA seq 174 aa AA seqDB search
MKAYYYDNLPGDQRLPHEDTSAGPLSPADLETVGVRYYHMPELAGVDALAAERGYKNRDE
ITVSPEKMGDAYESKVRMFFDEHLHEDEEIRYVRDGRGYFDVRDKADRWVRIALEKDDLI
ILPPGIYHRFTTDESNYIHAMRLFKEEPKWTPLNRSETVDQNPYRKEYVSQYLA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctactactacgacaacctcccgggcgaccaacggctgccgcacgaggacacc
agcgccgggccgctctcccccgccgacctcgagacggtcggggtgcgctactaccacatg
cccgagctggcgggcgtggacgcgctggcggccgagcgcgggtacaagaaccgggacgag
atcacggtgtcgccggagaagatgggcgacgcgtacgagtccaaggtcaggatgttcttc
gacgagcacctgcacgaggacgaggagatccgctacgtccgcgacgggcgcgggtacttt
gacgtgcgcgacaaggcggaccgctgggtccggatcgccctggagaaggacgatctgatt
attctgccgccgggcatctaccatcggttcaccaccgatgagagcaactacatccacgcg
atgcgcctgttcaaggaggagcccaagtggacgccgttgaaccggtccgagaccgtagat
cagaacccgtaccgcaaggagtatgtttcgcaatacctggcgtag

DBGET integrated database retrieval system